TkA08G388950 | RubberDandelionOmics

Gene overview

TkA08G388950

Reference: TK1151 Chr: Chr08 Coordinates: 99202634-99203677 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1044 bp · TkA08G388950|TK1151|cDNA

ATGTCATGTACGCCGTCGGACCGGGAAGCATTGTTGGCGTTCAAGTCCGCCTTGAACGAGCCTTATTTGGGCATATTCAAGACCTGGACCGGCACAGACTGCTGCACTAACTGGTATGGTGTCAGCTGCGACCCGACGGACAGTCGGGTGAATGATGTTATACTACGTGGTGAGTCGGAAGACAAGATTTTCGAGAAGGCAGGCCGGTCTGGGTACATGACCGGTTCACTCTCTCCTTCACTCTGCTCGCTCGACCGGCT...

CDS

Download CDS FASTA

1044 bp · TkA08G388950|TK1151|CDS

ATGTCATGTACGCCGTCGGACCGGGAAGCATTGTTGGCGTTCAAGTCCGCCTTGAACGAGCCTTATTTGGGCATATTCAAGACCTGGACCGGCACAGACTGCTGCACTAACTGGTATGGTGTCAGCTGCGACCCGACGGACAGTCGGGTGAATGATGTTATACTACGTGGTGAGTCGGAAGACAAGATTTTCGAGAAGGCAGGCCGGTCTGGGTACATGACCGGTTCACTCTCTCCTTCACTCTGCTCGCTCGACCGGCT...

Protein

Download Protein FASTA

347 aa · TkA08G388950|TK1151|PROTEIN

MSCTPSDREALLAFKSALNEPYLGIFKTWTGTDCCTNWYGVSCDPTDSRVNDVILRGESEDKIFEKAGRSGYMTGSLSPSLCSLDRLTTLVVADWKGISGEIPACLTSLSHLRILDLIGNQITGKIPADIGKLGKLTVLNVADNKISGEIPSSIVNLASLMHLDLSNNQITGVLPADLGKLSMMSRALLNRNQITGSIPSSIAGIYRLADLDLSMNMISGSIPAQVGSMPVLSTLNLDSNKLTGEIPVSLLSNTGLNIVN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G388950`
TK1151 ID	TkA08G388950
OH-1004 ID	LXL04_010403
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	82.500
Protein coverage (%)	TK1151 34.582 / OH-1004 32.877 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G388950

Location Chr08:99202634-99203677 (+)

Description Similar to DRT100: DNA damage-repair/toleration protein DRT100

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g12610`	This protein is able to complement bacterial recA mutations, but its native function in the plant is not known.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_010403 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006281 DNA repair Biological Process

GO:0007165 signal transduction Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0048046 apoplast Cellular Component

GO:0000166 nucleotide binding Molecular Function

KEGG gene cross-reference

ath:AT2G15080

ath:AT3G12610

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.613

Rank 1 · TkA08G388950 · TK1151

Extracellular0.169

Rank 2 · TkA08G388950 · TK1151

Endoplasmic reticulum0.100

Rank 3 · TkA08G388950 · TK1151

Cytoplasm0.087

Rank 4 · TkA08G388950 · TK1151

Nucleus0.040

Rank 5 · TkA08G388950 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08263LRRNT_25-44 aa

PF12799LRR_476-92 aa

PF23598LRR_1479-185 aa

PF25013LRR_Zer-183-118 aa

PF12799LRR_487-123 aa

PF25372LRR_FBXL1590-154 aa

PF00560LRR_197-109 aa

PF23211LRR_LRWD198-122 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G388950	`PF08263`	LRRNT_2	5	44	9.7e-13	48.9
TkA08G388950	`PF12799`	LRR_4	76	92	1.4e-14	54.4
TkA08G388950	`PF23598`	LRR_14	79	185	3.3e-16	59.7
TkA08G388950	`PF25013`	LRR_Zer-1	83	118	0.00012	23.0
TkA08G388950	`PF12799`	LRR_4	87	123	1.4e-14	54.4
TkA08G388950	`PF25372`	LRR_FBXL15	90	154	0.19	10.8
TkA08G388950	`PF00560`	LRR_1	97	109	6.5e-30	97.4
TkA08G388950	`PF23211`	LRR_LRWD1	98	122	0.00011	22.7
TkA08G388950	`PF13855`	LRR_8	103	146	1.3e-24	86.5
TkA08G388950	`PF25013`	LRR_Zer-1	105	171	0.00012	23.0
TkA08G388950	`PF27087`	LRR_TMOD-LMOD	106	126	4.0	7.7
TkA08G388950	`PF13516`	LRR_6	110	125	3.4e-08	33.7
TkA08G388950	`PF00560`	LRR_1	111	133	6.5e-30	97.4
TkA08G388950	`PF12799`	LRR_4	111	146	1.4e-14	54.4
TkA08G388950	`PF24141`	LRR_ComC	116	201	4.2e-07	30.7
TkA08G388950	`PF23211`	LRR_LRWD1	131	184	0.00011	22.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q00874`	Arabidopsis thaliana	sp\|Q00874\|DR100_ARATH DNA damage-repair/toleration protein DRT100	66.900%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card