LXL04_010403 | RubberDandelionOmics

Gene overview

LXL04_010403

Reference: OH-1004 Chr: Chr02 Coordinates: 146125432-146126529 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1098 bp · LXL04_010403|LXL04_010403|OH1004|cDNA

ATGGATACTACTACATACCTGGTGGTGACGACGGCACTATTCGCCGCCATCGTCAACTGCTGCCCGCCGGCGGACCGGTCAGCATTGTTGGCCTTCAAGTCCGCCCTGACAGAGCCTAACTTTGGCATCTTCGACACCTGGACCGGCACCGACTGCTGTACTAACTGGTACGGTGTCAGCTGCGACCCAACTGACAATCGTGTCATCCACATTATCCTACGCGGCGAGTCGGAAGACAAGATCATCGACAAAGCCGGCAA...

CDS

Download CDS FASTA

1098 bp · LXL04_010403|LXL04_010403|OH1004|CDS

ATGGATACTACTACATACCTGGTGGTGACGACGGCACTATTCGCCGCCATCGTCAACTGCTGCCCGCCGGCGGACCGGTCAGCATTGTTGGCCTTCAAGTCCGCCCTGACAGAGCCTAACTTTGGCATCTTCGACACCTGGACCGGCACCGACTGCTGTACTAACTGGTACGGTGTCAGCTGCGACCCAACTGACAATCGTGTCATCCACATTATCCTACGCGGCGAGTCGGAAGACAAGATCATCGACAAAGCCGGCAA...

Protein

Download Protein FASTA

365 aa · LXL04_010403|LXL04_010403|OH1004|PROTEIN

MDTTTYLVVTTALFAAIVNCCPPADRSALLAFKSALTEPNFGIFDTWTGTDCCTNWYGVSCDPTDNRVIHIILRGESEDKIIDKAGKTSYMSGSLSPSLCSLDRLTTLIVADWKGISGEIPVCITSLPHLRILDLIGNQITGEIPTDIGKLGILTVLNFANNNITGKIPPSIVNLGNLMHLDLSNNRISGEIPSDIGKLSMMSRALLKQNQLTGSVPISITKIYRLADLDLSMNQISGTIPAELGSMPVLSTLYLDNNQL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_010403`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_010403

Location Chr02:146125432-146126529 (-)

Description Similar to DRT100: DNA damage-repair/toleration protein DRT100

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g12610`	This protein is able to complement bacterial recA mutations, but its native function in the plant is not known.	No verified direct reference in this release
`At2g15080`	Receptor-like protein 19.	No verified direct reference in this release
`At3g11010`	Receptor-like protein 34.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_010403 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006281 DNA repair Biological Process

GO:0007165 signal transduction Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0048046 apoplast Cellular Component

GO:0000166 nucleotide binding Molecular Function

KEGG gene cross-reference

ath:AT2G15080

ath:AT3G12610

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.407

Rank 1 · LXL04_010403 · OH-1004

Extracellular0.300

Rank 2 · LXL04_010403 · OH-1004

Endoplasmic reticulum0.116

Rank 3 · LXL04_010403 · OH-1004

Cytoplasm0.093

Rank 4 · LXL04_010403 · OH-1004

Lysosome / Vacuole0.038

Rank 5 · LXL04_010403 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08263.18LRRNT_223-62 aa

PF23598.2LRR_14101-203 aa

PF13855.13LRR_8128-188 aa

PF12799.14LRR_4154-189 aa

PF00560.40LRR_1177-199 aa

PF13855.13LRR_8207-260 aa

PF13855.13LRR_8273-332 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_010403	`PF08263.18`	LRRNT_2	23	62	8.9e-12	45.8
LXL04_010403	`PF23598.2`	LRR_14	101	203	5.8e-17	62.2
LXL04_010403	`PF13855.13`	LRR_8	128	188	5.3e-20	71.7
LXL04_010403	`PF12799.14`	LRR_4	154	189	3.2e-15	56.5
LXL04_010403	`PF00560.40`	LRR_1	177	199	1.7e-28	93.2
LXL04_010403	`PF13855.13`	LRR_8	207	260	5.3e-20	71.7
LXL04_010403	`PF13855.13`	LRR_8	273	332	5.3e-20	71.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q00874`	Arabidopsis thaliana	DNA damage-repair/toleration protein DRT100	60.231%	Swiss-Prot	strong database homology
`Q9ZUK3`	Arabidopsis thaliana	Receptor-like protein 19	31.322%	Swiss-Prot	moderate database homology
`Q9SRL2`	Arabidopsis thaliana	Receptor-like protein 34	34.957%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card