TkA08G368130 | RubberDandelionOmics

Gene overview

TkA08G368130

Reference: TK1151 Chr: Chr08 Coordinates: 94270568-94271242 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

414 bp · TkA08G368130|TK1151|cDNA

ATGGTCATCGCCGGAAGACAAGGCGCTGCCATATCGCTGAGTGACCGGAATCGCCTGGAGCAGATCGTGTGGTACAGCACCGGTAAGTGTTCTATCTCCTTTTTCTTCACCGCTAATCTAGCATCTTCACCTCCGCCGTCGGTTGTTGCACCCCCGGAGAGTAAGTCCATGGAGGCCACTAGCTTTGGCCTAGTTGAAGACCAATTCGTCGATGCCAGTTTGAGATTGATATATTATGAGGAGGTCGACGACCGTAAGTT...

CDS

Download CDS FASTA

414 bp · TkA08G368130|TK1151|CDS

ATGGTCATCGCCGGAAGACAAGGCGCTGCCATATCGCTGAGTGACCGGAATCGCCTGGAGCAGATCGTGTGGTACAGCACCGGTAAGTGTTCTATCTCCTTTTTCTTCACCGCTAATCTAGCATCTTCACCTCCGCCGTCGGTTGTTGCACCCCCGGAGAGTAAGTCCATGGAGGCCACTAGCTTTGGCCTAGTTGAAGACCAATTCGTCGATGCCAGTTTGAGATTGATATATTATGAGGAGGTCGACGACCGTAAGTT...

Protein

Download Protein FASTA

137 aa · TkA08G368130|TK1151|PROTEIN

MVIAGRQGAAISLSDRNRLEQIVWYSTGKCSISFFFTANLASSPPPSVVAPPESKSMEATSFGLVEDQFVDASLRLIYYEEVDDRKFKYLAPSHGAKFNKGSNSIRAVTLQSRKAPADEFISFIRSYVVPEGFPDSV

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G368130`
TK1151 ID	TkA08G368130
OH-1004 ID	LXL04_022436
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	94.100
Protein coverage (%)	TK1151 99.270 / OH-1004 62.963 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G368130

Location Chr08:94270568-94271242 (-)

Description Similar to RUS6: Protein root UVB sensitive 6

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g49820`	Required for normal embryo development.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_022436 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009926 auxin polar transport Biological Process

GO:0010224 response to UV-B Biological Process

GO:0048653 anther development Biological Process

GO:0009507 chloroplast Cellular Component

GO:0009536 plastid Cellular Component

GO:0009941 chloroplast envelope Cellular Component

GO:0016020 membrane Cellular Component

KEGG gene cross-reference

ath:AT2G23470

ath:AT2G31190

ath:AT5G49820

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.330

Rank 1 · TkA08G368130 · TK1151

Cytoplasm0.308

Rank 2 · TkA08G368130 · TK1151

Plastid0.184

Rank 3 · TkA08G368130 · TK1151

Mitochondrion0.131

Rank 4 · TkA08G368130 · TK1151

Cell membrane0.096

Rank 5 · TkA08G368130 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF24162RUS6_N37-114 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G368130	`PF24162`	RUS6_N	37	114	8.7e-17	61.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q93YU2`	Arabidopsis thaliana	sp\|Q93YU2\|RUS6_ARATH Protein root UVB sensitive 6	48.100%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card