LXL04_022436 | RubberDandelionOmics

Gene overview

LXL04_022436

Reference: OH-1004 Chr: Chr04 Coordinates: 150350063-150351640 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

651 bp · LXL04_022436|LXL04_022436|OH1004|cDNA

ATGGTCGTCGCCGGAAGACAAGGCGCTGCCATATCGCTGAGTGACCGGAATCGCCTGGAGCAGATCATGTGGTACAGCACCGGTAAGTGTTCTATCTCCTTTTTCTTCACCGCTAATCTAGCATCTTCACCTCCGCCGTCGGTTGTTGCGCCCCCGGAGAGTAAGTCCTTGGAGGCCACTAGCTTTGGCCTAGTTGAAGACCAATTCGTCGATGCCAGTTTGAGATTGACTTGTTATGAGGAGGTCGACGGCCGTAAGTT...

CDS

Download CDS FASTA

651 bp · LXL04_022436|LXL04_022436|OH1004|CDS

ATGGTCGTCGCCGGAAGACAAGGCGCTGCCATATCGCTGAGTGACCGGAATCGCCTGGAGCAGATCATGTGGTACAGCACCGGTAAGTGTTCTATCTCCTTTTTCTTCACCGCTAATCTAGCATCTTCACCTCCGCCGTCGGTTGTTGCGCCCCCGGAGAGTAAGTCCTTGGAGGCCACTAGCTTTGGCCTAGTTGAAGACCAATTCGTCGATGCCAGTTTGAGATTGACTTGTTATGAGGAGGTCGACGGCCGTAAGTT...

Protein

Download Protein FASTA

216 aa · LXL04_022436|LXL04_022436|OH1004|PROTEIN

MVVAGRQGAAISLSDRNRLEQIMWYSTGKCSISFFFTANLASSPPPSVVAPPESKSLEATSFGLVEDQFVDASLRLTCYEEVDGRKFKYLAPSHGVKFNKGSNSIRVVTLQSRKAPADEFISFIRSYVVPEGFPDSHFFGGAMGVFTTQALLHSVDVSKNQAMPGAVAINWTIKDGSGRIGDLLMELGAGVELATTAALHLFLPLACAANVAKVVE

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_022436`
TK1151 ID	TkA08G368130
OH-1004 ID	LXL04_022436
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	94.100
Protein coverage (%)	TK1151 99.270 / OH-1004 62.963 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_022436

Location Chr04:150350063-150351640 (+)

Description Similar to RUS6: Protein root UVB sensitive 6

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g49820`	Required for normal embryo development.	No verified direct reference in this release
`At2g23470`	Protein root UVB sensitive 4.	No verified direct reference in this release
`At2g31190`	Involved in a root UV-B sensing pathway and in the protection against the hypersensitivity to very low-fluence-rate (VLF) UV-B.	ROOT UV-B SENSITIVE2 acts with ROOT UV-B SENSITIVE1 in a root ultraviolet B-sensing pathway.2009 · DOI: 10.1104/pp.109.139253 Arabidopsis ROOT UVB SENSITIVE2/WEAK AUXIN RESPONSE1 is required for polar auxin transport.2010 · DOI: 10.1105/tpc.110.074195

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_022436 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009926 auxin polar transport Biological Process

GO:0010224 response to UV-B Biological Process

GO:0048653 anther development Biological Process

GO:0009507 chloroplast Cellular Component

GO:0009536 plastid Cellular Component

GO:0009941 chloroplast envelope Cellular Component

GO:0016020 membrane Cellular Component

KEGG gene cross-reference

ath:AT2G23470

ath:AT2G31190

ath:AT5G49820

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.439

Rank 1 · LXL04_022436 · OH-1004

Cytoplasm0.195

Rank 2 · LXL04_022436 · OH-1004

Nucleus0.173

Rank 3 · LXL04_022436 · OH-1004

Mitochondrion0.163

Rank 4 · LXL04_022436 · OH-1004

Cell membrane0.087

Rank 5 · LXL04_022436 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF24162.2RUS6_N37-114 aa

PF04884.21UVB_sens_prot136-184 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_022436	`PF24162.2`	RUS6_N	37	114	6e-18	65.4
LXL04_022436	`PF04884.21`	UVB_sens_prot	136	184	6.3e-13	49.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q93YU2`	Arabidopsis thaliana	Protein root UVB sensitive 6	50.732%	Swiss-Prot	strong database homology
`Q67YT8`	Arabidopsis thaliana	Protein root UVB sensitive 4	26.400%	Swiss-Prot	weak database homology
`Q9SJX7`	Arabidopsis thaliana	Protein root UVB sensitive 2, chloroplastic	28.302%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card