Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1485 bp · TkA08G322120|TK1151|cDNA
ATGCAGGCCCAATTTGTAAGCAATGATGCAGGATATATCGGATGCAAGAAGAAGGAATGTAAAAAATATGATCAAAGGGGAAGGTGTGTGGTGACAACATGTAGCGCGTCAATCACATTTCATGTTATCAATATCAGAAGTGATATTCAGTTTGTCTTCTTTGGCGGCGGATTTCAAGTACCTTGCGTTTTAGCAATTTCTGAACTTCTCAAGTTTGCAAATCCAAAGAAACCATTGTATGGGCATCTCTCTAGTGTTGA...
1485 bp · TkA08G322120|TK1151|CDS
ATGCAGGCCCAATTTGTAAGCAATGATGCAGGATATATCGGATGCAAGAAGAAGGAATGTAAAAAATATGATCAAAGGGGAAGGTGTGTGGTGACAACATGTAGCGCGTCAATCACATTTCATGTTATCAATATCAGAAGTGATATTCAGTTTGTCTTCTTTGGCGGCGGATTTCAAGTACCTTGCGTTTTAGCAATTTCTGAACTTCTCAAGTTTGCAAATCCAAAGAAACCATTGTATGGGCATCTCTCTAGTGTTGA...
Protein
Download Protein FASTA494 aa · TkA08G322120|TK1151|PROTEIN
MQAQFVSNDAGYIGCKKKECKKYDQRGRCVVTTCSASITFHVINIRSDIQFVFFGGGFQVPCVLAISELLKFANPKKPLYGHLSSVDSTGTSMRLTWVSGDKNPQQVQYGNGKSQASRVTTFSQDSMCTSALPSPAKDFGWHDPGYIHSAVMTGLKPSTRFSYRYGSKSAGWSGRINFRTPPSAGSNELKFLAFGDMGKAPRDASIEHYIQPGSIAVTQAMVDELSSGNVDSIFHIGDISYATGFLVEWDFFLHLITPVA...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA08G322120 |
|---|---|
| TK1151 ID | TkA08G322120 |
| OH-1004 ID | LXL04_010468 |
| Relationship / confidence | Multi Source To Oh1004 / Complex relationship |
| Protein identity (%) | 37.300 |
| Protein coverage (%) | TK1151 99.190 / OH-1004 79.299Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA08G322120 | ||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr08:83112665-83115769 (-) | ||||||||||||||||||
| Description | Similar to PAP27: Probable inactive purple acid phosphatase 27 | ||||||||||||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | ||||||||||||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | ||||||||||||||||||
| GO annotations (OH1004 source) | GO:0045037 protein import into chloroplast stroma Biological Process GO:0005576 extracellular region Cellular Component GO:0009505 plant-type cell wall Cellular Component GO:0009507 chloroplast Cellular Component GO:0009707 chloroplast outer membrane Cellular Component GO:0003993 acid phosphatase activity Molecular Function GO:0016787 hydrolase activity Molecular Function GO:0046872 metal ion binding Molecular Function | ||||||||||||||||||
| KEGG gene cross-reference | ath:AT1G13750 ath:AT2G03450 ath:AT4G24890 ath:AT5G50400 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF17808fn3_PAP3-74 aaPF16656Pur_ac_phosph_N80-180 aaPF14008Metallophos_C89-103 aaPF00149Metallophos189-398 aaPF12850Metallophos_2215-399 aaPF16656Pur_ac_phosph_N325-325 aaPF17808fn3_PAP357-357 aaPF14008Metallophos_C430-487 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA08G322120 | PF17808 | fn3_PAP | 3 | 74 | 2.5e-13 | 50.8 |
| TkA08G322120 | PF16656 | Pur_ac_phosph_N | 80 | 180 | 3e-18 | 66.9 |
| TkA08G322120 | PF14008 | Metallophos_C | 89 | 103 | 1.3e-12 | 48.8 |
| TkA08G322120 | PF00149 | Metallophos | 189 | 398 | 4.4e-19 | 70.4 |
| TkA08G322120 | PF12850 | Metallophos_2 | 215 | 399 | 0.017 | 15.9 |
| TkA08G322120 | PF16656 | Pur_ac_phosph_N | 325 | 325 | 3e-18 | 66.9 |
| TkA08G322120 | PF17808 | fn3_PAP | 357 | 357 | 2.5e-13 | 50.8 |
| TkA08G322120 | PF14008 | Metallophos_C | 430 | 487 | 1.3e-12 | 48.8 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
| Protein | Organism | Description | Identity | Database | Confidence |
|---|---|---|---|---|---|
Q5MAU8 | Arabidopsis thaliana | sp|Q5MAU8|PPA27_ARATH Probable inactive purple acid phosphatase 27 | 37.500% | Swiss-Prot | Medium |
Q9LMX4 | Arabidopsis thaliana | sp|Q9LMX4|PPA1_ARATH Probable inactive purple acid phosphatase 1 | 37.200% | Swiss-Prot | Medium |
Q9LMG7 | Arabidopsis thaliana | sp|Q9LMG7|PPA2_ARATH Probable inactive purple acid phosphatase 2 | 35.900% | Swiss-Prot | Medium |
Q9ZQ81 | Arabidopsis thaliana | sp|Q9ZQ81|PPA9_ARATH Probable inactive purple acid phosphatase 9 | 34.000% | Swiss-Prot | Medium |
Q9C510 | Arabidopsis thaliana | sp|Q9C510|PPA6_ARATH Purple acid phosphatase 6 | 27.100% | Swiss-Prot | Low |