TkA08G302710 | RubberDandelionOmics

Gene overview

TkA08G302710

Reference: TK1151 Chr: Chr08 Coordinates: 78389001-78399278 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

450 bp · TkA08G302710|TK1151|cDNA

ATGGGGGGGGGAGGTATTCCCACGAGGGAGAAGCTGTCTGTTCGTGGGATTCAGCTAGATTCAATTTTGTGTCCCATCTGTGAGAGGAGAGAGGAGACTGTAACACATCTATTCTTTGAATGTGATTTGTCTTCACAATTATGGAGTAAATTAGGTGTTTGGTGGGCTGTCCAAATCCCGTCACTTAGTACAGGAGAGGAGTTGATGAATTGGTCGTGGTTTAGCATGAAGAACAGGAAAGACGGGGTAAACATGCAGGT...

CDS

Download CDS FASTA

450 bp · TkA08G302710|TK1151|CDS

ATGGGGGGGGGAGGTATTCCCACGAGGGAGAAGCTGTCTGTTCGTGGGATTCAGCTAGATTCAATTTTGTGTCCCATCTGTGAGAGGAGAGAGGAGACTGTAACACATCTATTCTTTGAATGTGATTTGTCTTCACAATTATGGAGTAAATTAGGTGTTTGGTGGGCTGTCCAAATCCCGTCACTTAGTACAGGAGAGGAGTTGATGAATTGGTCGTGGTTTAGCATGAAGAACAGGAAAGACGGGGTAAACATGCAGGT...

Protein

Download Protein FASTA

149 aa · TkA08G302710|TK1151|PROTEIN

MGGGGIPTREKLSVRGIQLDSILCPICERREETVTHLFFECDLSSQLWSKLGVWWAVQIPSLSTGEELMNWSWFSMKNRKDGVNMQVAIMAIIISIWRARNGVIYDKKKVEVVKEFRNAQELAYFWLISRNSKFKTELCNWISNPKNIM

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G302710`
TK1151 ID	TkA08G302710
OH-1004 ID	LXL04_000404
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	80.300
Protein coverage (%)	TK1151 88.591 / OH-1004 10.602 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA08G302710`
Location	Chr08:78389001-78399278 (-)
Description	Similar to ZAR1: Receptor protein kinase-like protein ZAR1
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_000404` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0009789 positive regulation of abscisic acid-activated signaling pathway Biological Process GO:0010030 positive regulation of seed germination Biological Process GO:0010069 zygote asymmetric cytokinesis in embryo sac Biological Process GO:0010070 zygote asymmetric cell division Biological Process GO:0042631 cellular response to water deprivation Biological Process GO:0046777 protein autophosphorylation Biological Process GO:0062207 regulation of pattern recognition receptor signaling pathway Biological Process GO:0005576 extracellular region Cellular Component GO:0005777 peroxisome Cellular Component GO:0005886 plasma membrane Cellular Component GO:0009505 plant-type cell wall Cellular Component GO:0009507 chloroplast Cellular Component
KEGG gene cross-reference	ath:AT1G66830 ath:AT2G01210 ath:AT2G26730 ath:AT4G34220 ath:AT4G37250 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.363

Rank 1 · TkA08G302710 · TK1151

Cell membrane0.348

Rank 2 · TkA08G302710 · TK1151

Nucleus0.133

Rank 3 · TkA08G302710 · TK1151

Endoplasmic reticulum0.107

Rank 4 · TkA08G302710 · TK1151

Golgi apparatus0.098

Rank 5 · TkA08G302710 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13966zf-RVT5-48 aa

PF13966zf-RVT54-73 aa

PF13966zf-RVT126-137 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G302710	`PF13966`	zf-RVT	5	48	4.1e-10	40.9
TkA08G302710	`PF13966`	zf-RVT	54	73	4.1e-10	40.9
TkA08G302710	`PF13966`	zf-RVT	126	137	4.1e-10	40.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card