LXL04_000404 | RubberDandelionOmics

Gene overview

LXL04_000404

Reference: OH-1004 Chr: Chr01 Coordinates: 7483663-7492864 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

4014 bp · LXL04_000404|LXL04_000404|OH1004|cDNA

ATGATTCCCGTCAAATTTCATCTCTTCTTCTGTGTTTCTTTAATCTGTTTTTCTGTTTCTTCTTCATTGAACTCCGATGGGCTTTCACTGCTGGCACTCAAGGCCGCCGTCACCGGTGATCCTAGTAACTCCCTCGCCACCTGGAGGGAGACAGATTCAACGCCGTGCCGCTGGACTGGCGTCGCCTGCAACTCCGACCACCGTGTCACTAGCATTTTTCTACCCAATAAGAATCTCACTGGCTACCTTCCATCGGAGCT...

CDS

Download CDS FASTA

3738 bp · LXL04_000404|LXL04_000404|OH1004|CDS

ATGATTCCCGTCAAATTTCATCTCTTCTTCTGTGTTTCTTTAATCTGTTTTTCTGTTTCTTCTTCATTGAACTCCGATGGGCTTTCACTGCTGGCACTCAAGGCCGCCGTCACCGGTGATCCTAGTAACTCCCTCGCCACCTGGAGGGAGACAGATTCAACGCCGTGCCGCTGGACTGGCGTCGCCTGCAACTCCGACCACCGTGTCACTAGCATTTTTCTACCCAATAAGAATCTCACTGGCTACCTTCCATCGGAGCT...

Protein

Download Protein FASTA

1245 aa · LXL04_000404|LXL04_000404|OH1004|PROTEIN

MIPVKFHLFFCVSLICFSVSSSLNSDGLSLLALKAAVTGDPSNSLATWRETDSTPCRWTGVACNSDHRVTSIFLPNKNLTGYLPSELGAILSLRHLSLYNNNFSKLIPDHLFNATNLLSIDLSHNHLTGPIPEKITSLKFLTSLDLSSNFLNGSLPESLSNLTNLSGTLNLSYNQLSGEIPASYGLFQVMVSLDLRHNNLTGKIPLVGSLLNQGPTAFTGNPFLCGFPLETQCSDPEAQNPRTLSNPDTPKDPGSSIGLS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_000404`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_000404

Location Chr01:7483663-7492864 (+)

Description Similar to ZAR1: Receptor protein kinase-like protein ZAR1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g01210`	Receptor protein kinase acting as an integrator for intracellular calcium and heterotrimeric G protein signaling with extracellular signals during early zygote development.	No verified direct reference in this release
`At1g66830`	Probable inactive leucine-rich repeat receptor-like protein kinase At1g66830.	No verified direct reference in this release
`At4g37250`	Probable LRR receptor-like serine/threonine-protein kinase At4g37250.	No verified direct reference in this release
`At4g34220`	Receptor protein kinase-like protein At4g34220.	No verified direct reference in this release
`At2g26730`	Probable inactive receptor kinase At2g26730.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_000404 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009789 positive regulation of abscisic acid-activated signaling pathway Biological Process

GO:0010030 positive regulation of seed germination Biological Process

GO:0010069 zygote asymmetric cytokinesis in embryo sac Biological Process

GO:0010070 zygote asymmetric cell division Biological Process

GO:0042631 cellular response to water deprivation Biological Process

GO:0046777 protein autophosphorylation Biological Process

GO:0062207 regulation of pattern recognition receptor signaling pathway Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005777 peroxisome Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0009507 chloroplast Cellular Component

KEGG gene cross-reference

ath:AT1G66830

ath:AT2G01210

ath:AT2G26730

ath:AT4G34220

ath:AT4G37250

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.727

Rank 1 · LXL04_000404 · OH-1004

Cytoplasm0.147

Rank 2 · LXL04_000404 · OH-1004

Nucleus0.122

Rank 3 · LXL04_000404 · OH-1004

Endoplasmic reticulum0.061

Rank 4 · LXL04_000404 · OH-1004

Golgi apparatus0.029

Rank 5 · LXL04_000404 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08263.18LRRNT_223-64 aa

PF00069.32Pkinase350-572 aa

PF07714.24PK_Tyr_Ser-Thr350-641 aa

PF00078.33RVT_1716-850 aa

PF13966.12zf-RVT1087-1155 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_000404	`PF08263.18`	LRRNT_2	23	64	8.5e-13	49.1
LXL04_000404	`PF00069.32`	Pkinase	350	572	4.8e-24	85.9
LXL04_000404	`PF07714.24`	PK_Tyr_Ser-Thr	350	641	1.7e-23	84.0
LXL04_000404	`PF00078.33`	RVT_1	716	850	5.2e-09	37.0
LXL04_000404	`PF13966.12`	zf-RVT	1087	1155	1.3e-16	61.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ZU46`	Arabidopsis thaliana	Receptor protein kinase-like protein ZAR1	37.756%	Swiss-Prot	moderate database homology
`Q9C9N5`	Arabidopsis thaliana	Probable inactive leucine-rich repeat receptor-like protein kinase At1g66830	36.045%	Swiss-Prot	moderate database homology
`C0LGS3`	Arabidopsis thaliana	Probable LRR receptor-like serine/threonine-protein kinase At4g37250	33.377%	Swiss-Prot	moderate database homology
`Q94C77`	Arabidopsis thaliana	Receptor protein kinase-like protein At4g34220	31.532%	Swiss-Prot	moderate database homology
`O48788`	Arabidopsis thaliana	Probable inactive receptor kinase At2g26730	35.115%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card