Gene Card
Gene overview
cDNA / CDS / Protein Sequences
324 bp · TkA08G288340|TK1151|cDNA
ATGGCATTGCAACGTACAATAGAATTTGAGGAAGACTTGGCAGAGAAATTTGGTGGTAGTGGTAGTAGCAGAATTGTAACAAATGATTTTGAGGAAACGAATAAATCAGAAAGTAATAATAATAATCAAATTGTACAAGACATTCGTAAGAAATATGAGAAAAAACTTGCTGCACATCAGGATGATGTAAGACATACTGATTACTTCTTTAAGATAATATATATATATATATATATAGAAGTAAGTTCATATAATAACAT...
324 bp · TkA08G288340|TK1151|CDS
ATGGCATTGCAACGTACAATAGAATTTGAGGAAGACTTGGCAGAGAAATTTGGTGGTAGTGGTAGTAGCAGAATTGTAACAAATGATTTTGAGGAAACGAATAAATCAGAAAGTAATAATAATAATCAAATTGTACAAGACATTCGTAAGAAATATGAGAAAAAACTTGCTGCACATCAGGATGATGTAAGACATACTGATTACTTCTTTAAGATAATATATATATATATATATATAGAAGTAAGTTCATATAATAACAT...
Protein
Download Protein FASTA107 aa · TkA08G288340|TK1151|PROTEIN
MALQRTIEFEEDLAEKFGGSGSSRIVTNDFEETNKSESNNNNQIVQDIRKKYEKKLAAHQDDVRHTDYFFKIIYIYIYIEVSSYNNISYCENVRTVVDQSFYFIILM
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA08G288340 |
|---|---|
| TK1151 ID | TkA08G288340 |
| OH-1004 ID | LXL04_026818 |
| Relationship / confidence | Multi Source To Oh1004 / Complex relationship |
| Protein identity (%) | 93.500 |
| Protein coverage (%) | TK1151 57.944 / OH-1004 7.552Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA08G288340 |
|---|---|
| Location | Chr08:74836688-74837095 (-) |
| Description | Similar to VPS53: Vacuolar protein sorting-associated protein 53 A |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0006622 protein targeting to lysosome Biological Process GO:0006890 retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum Biological Process GO:0006970 response to osmotic stress Biological Process GO:0007009 plasma membrane organization Biological Process GO:0007041 lysosomal transport Biological Process GO:0009408 response to heat Biological Process GO:0010286 heat acclimation Biological Process GO:0015031 protein transport Biological Process GO:0032456 endocytic recycling Biological Process GO:0042147 retrograde transport, endosome to Golgi Biological Process GO:0090119 vesicle-mediated cholesterol transport Biological Process GO:0000139 Golgi membrane Cellular Component |
| KEGG gene cross-reference | ath:AT1G50500 ath:AT1G50970 mmu:68299 pon:100173757 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF04100Vps53_N1-80 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA08G288340 | PF04100 | Vps53_N | 1 | 80 | 0.012 | 15.4 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.