LXL04_026818 | RubberDandelionOmics

Gene overview

LXL04_026818

Reference: OH-1004 Chr: Chr06 Coordinates: 3382033-3389962 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2466 bp · LXL04_026818|LXL04_026818|OH1004|cDNA

ATGGAGAAGTCGAGTACTTTGGACTACATCAACCAGATGTTCCCTACAGAAGCATCTTTATCTGGTGTCGAGCCACTGATGCAAAAAGTACACAGTGAGATACGCGTTGTGGATACTGAAATTCTAGCTGCTGTTCGTCAACAGAGTAATTCGGGTACAAAAGCAAAGGAGGATCTGGCTGCAGCTACACGTGCTGTGGAGGAACTCATGTATAAAGTCAGGGAAATTAAAACCAAAGCAGAACAAAGTGAAACAATGGT...

CDS

Download CDS FASTA

2466 bp · LXL04_026818|LXL04_026818|OH1004|CDS

ATGGAGAAGTCGAGTACTTTGGACTACATCAACCAGATGTTCCCTACAGAAGCATCTTTATCTGGTGTCGAGCCACTGATGCAAAAAGTACACAGTGAGATACGCGTTGTGGATACTGAAATTCTAGCTGCTGTTCGTCAACAGAGTAATTCGGGTACAAAAGCAAAGGAGGATCTGGCTGCAGCTACACGTGCTGTGGAGGAACTCATGTATAAAGTCAGGGAAATTAAAACCAAAGCAGAACAAAGTGAAACAATGGT...

Protein

Download Protein FASTA

821 aa · LXL04_026818|LXL04_026818|OH1004|PROTEIN

MEKSSTLDYINQMFPTEASLSGVEPLMQKVHSEIRVVDTEILAAVRQQSNSGTKAKEDLAAATRAVEELMYKVREIKTKAEQSETMVQEICRDIKKLDFAKKHITTTITALHRLTMLVSAIEQLQVMASKRQYKEASAQLEAVSQLCSHFDGYRDNPKITELRDKFKNIKQILKSHVYSDFSSLGTGKETEDSSLLQHLTDACLVVDALEPSVREELVKNFCDRELISYQQIFEGAELAKLDKTERRYAWVKRRLRTNEE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_026818`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_026818

Location Chr06:3382033-3389962 (+)

Description Similar to VPS53: Vacuolar protein sorting-associated protein 53 A

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g50500`	Acts as a component of the GARP complex that is involved in retrograde transport from early and late endosomes to the trans-Golgi network (TGN).	Mutation in a homolog of yeast Vps53p accounts for the heat and osmotic hypersensitive phenotypes in Arabidopsis hit1-1 mutant.2006 · DOI: 10.1007/s00425-005-0216-6 The POK/AtVPS52 protein localizes to several distinct post-Golgi compartments in sporophytic and gametophytic cells.2008 · DOI: 10.1093/jxb/ern162 Involvement of the Arabidopsis HIT1/AtVPS53 tethering protein homologue in the acclimation of the plasma membrane to heat stress.2011 · DOI: 10.1093/jxb/err060 The Arabidopsis hit1-1 mutant has a plasma membrane profile distinct from that of wild-type plants at optimal growing temperature.2011 · DOI: 10.4161/psb.6.8.15842
`At1g50970`	Involved in retrograde transport from early and late endosomes to late Golgi, leading to the membrane fusion between late Golgi and endosomal vesicles.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026818 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006622 protein targeting to lysosome Biological Process

GO:0006890 retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum Biological Process

GO:0006970 response to osmotic stress Biological Process

GO:0007009 plasma membrane organization Biological Process

GO:0007041 lysosomal transport Biological Process

GO:0009408 response to heat Biological Process

GO:0010286 heat acclimation Biological Process

GO:0015031 protein transport Biological Process

GO:0032456 endocytic recycling Biological Process

GO:0042147 retrograde transport, endosome to Golgi Biological Process

GO:0090119 vesicle-mediated cholesterol transport Biological Process

GO:0000139 Golgi membrane Cellular Component

KEGG gene cross-reference

ath:AT1G50500

ath:AT1G50970

mmu:68299

pon:100173757

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Golgi apparatus0.563

Rank 1 · LXL04_026818 · OH-1004

Cytoplasm0.513

Rank 2 · LXL04_026818 · OH-1004

Cell membrane0.126

Rank 3 · LXL04_026818 · OH-1004

Endoplasmic reticulum0.125

Rank 4 · LXL04_026818 · OH-1004

Lysosome / Vacuole0.104

Rank 5 · LXL04_026818 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04100.19Vps53_N3-413 aa

PF16854.12VPS53_C642-720 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_026818	`PF04100.19`	Vps53_N	3	413	1.2e-134	449.8
LXL04_026818	`PF16854.12`	VPS53_C	642	720	1.9e-14	54.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q0WQF4`	Arabidopsis thaliana	Vacuolar protein sorting-associated protein 53 A	74.790%	Swiss-Prot	strong database homology
`F4I7Y2`	Arabidopsis thaliana	Vacuolar protein sorting-associated protein 53 B	59.189%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card