TkA08G276880 | RubberDandelionOmics

Gene overview

TkA08G276880

Reference: TK1151 Chr: Chr08 Coordinates: 72017322-72018540 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

759 bp · TkA08G276880|TK1151|cDNA

CAGCTAGGAACACAATTGTCAAAAACGGGTGTTTTGGACCGGCTACATGATCTCATCTGGGACGAAAGACTGAGTATAGATAAATTTGAAACTGGCTGGCAAACCATAATGGATGATTATGATTTACATACTAATAGTTGGTTTACGGATATGCTTGATGCATGCGAAAGTTGGGTTCCAGCATACTTTAAGGATTACCACTTATCAGGTTTGATGAGGACAACTTCAAGATCCGAAGGAAAATTATGTAGACATTGCAT...

CDS

Download CDS FASTA

759 bp · TkA08G276880|TK1151|CDS

CAGCTAGGAACACAATTGTCAAAAACGGGTGTTTTGGACCGGCTACATGATCTCATCTGGGACGAAAGACTGAGTATAGATAAATTTGAAACTGGCTGGCAAACCATAATGGATGATTATGATTTACATACTAATAGTTGGTTTACGGATATGCTTGATGCATGCGAAAGTTGGGTTCCAGCATACTTTAAGGATTACCACTTATCAGGTTTGATGAGGACAACTTCAAGATCCGAAGGAAAATTATGTAGACATTGCAT...

Protein

Download Protein FASTA

252 aa · TkA08G276880|TK1151|PROTEIN

QLGTQLSKTGVLDRLHDLIWDERLSIDKFETGWQTIMDDYDLHTNSWFTDMLDACESWVPAYFKDYHLSGLMRTTSRSEGKLCRHCIYVLRMSGVQHFPQHYAPRRWRKDVVPRTTDSYKELGRCKEADDIEAIVRELHASVDYCVDRLSSNLEKLHLYRDTQKCLKTKVDEDTIGEQPMSNKAFIKTVIGVRQKSDIQVKVPEGVRNKGSKKRLISEKEKEIINAKKGSRRCGGCGEYVDHNAQTCPNKNK

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G276880`
TK1151 ID	TkA08G276880
OH-1004 ID	LXL04_015931
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	58.700
Protein coverage (%)	TK1151 100.000 / OH-1004 54.714 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA08G276880`
Location	Chr08:72017322-72018540 (-)
Description	Similar to FRS5: Protein FAR1-RELATED SEQUENCE 5
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_015931` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006355 regulation of DNA-templated transcription Biological Process GO:0005634 nucleus Cellular Component GO:0009506 plasmodesma Cellular Component GO:0008270 zinc ion binding Molecular Function
KEGG gene cross-reference	ath:AT1G10240 ath:AT1G76320 ath:AT1G80010 ath:AT2G27110 ath:AT4G38180 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.931

Rank 1 · TkA08G276880 · TK1151

Cytoplasm0.129

Rank 2 · TkA08G276880 · TK1151

Extracellular0.019

Rank 3 · TkA08G276880 · TK1151

Mitochondrion0.016

Rank 4 · TkA08G276880 · TK1151

Cell membrane0.012

Rank 5 · TkA08G276880 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12773DZR79-86 aa

PF13248Zn_ribbon_381-86 aa

PF21547TTI1139-167 aa

PF12773DZR230-249 aa

PF13248Zn_ribbon_3232-249 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G276880	`PF12773`	DZR	79	86	0.044	14.7
TkA08G276880	`PF13248`	Zn_ribbon_3	81	86	1.2	9.4
TkA08G276880	`PF21547`	TTI1	139	167	0.26	11.9
TkA08G276880	`PF12773`	DZR	230	249	0.044	14.7
TkA08G276880	`PF13248`	Zn_ribbon_3	232	249	1.2	9.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card