LXL04_015931 | RubberDandelionOmics

Gene overview

LXL04_015931

Reference: OH-1004 Chr: Chr03 Coordinates: 98948386-98950722 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2103 bp · LXL04_015931|LXL04_015931|OH1004|cDNA

ATGAGTATGGGCGAGCATAAAGTAGTAGAGGATGCATTTGGGTTTTATAAAGAATACGGCCGGAAAAGTGGTTTTGAGATTAGGAAAGCAACAACAGAGGTATCAAAAACCGGGTTAGGTTATTCCCGAAGGTACATAGTGTGTAATAAGGAAGGGGAGAATAAGAAGAAAACGACATATGATTCGTTGAAAGAACAACGTAATAGACCTAGCCATCGGGTGAAGTGTAAAGCAAGTATTAGATTAAAAGTAGATGGTTC...

CDS

Download CDS FASTA

2103 bp · LXL04_015931|LXL04_015931|OH1004|CDS

ATGAGTATGGGCGAGCATAAAGTAGTAGAGGATGCATTTGGGTTTTATAAAGAATACGGCCGGAAAAGTGGTTTTGAGATTAGGAAAGCAACAACAGAGGTATCAAAAACCGGGTTAGGTTATTCCCGAAGGTACATAGTGTGTAATAAGGAAGGGGAGAATAAGAAGAAAACGACATATGATTCGTTGAAAGAACAACGTAATAGACCTAGCCATCGGGTGAAGTGTAAAGCAAGTATTAGATTAAAAGTAGATGGTTC...

Protein

Download Protein FASTA

700 aa · LXL04_015931|LXL04_015931|OH1004|PROTEIN

MSMGEHKVVEDAFGFYKEYGRKSGFEIRKATTEVSKTGLGYSRRYIVCNKEGENKKKTTYDSLKEQRNRPSHRVKCKASIRLKVDGSGRWEITHFEEKHTHDFVKPEDAHFLKSNRRLTYQQKQLLHDVSGINIGPVRAFKLMKQSQGGVSEVECKIFKSDFISIVGEGDVDLVIDKLSKKMEYLHDYTFEFCEDSDGVLSGLFWADEESKRNYTAFGQVVGFDATYRTNKYMMVFVPFTGIDNHQKCVTFAAGLLCSES...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_015931`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_015931

Location Chr03:98948386-98950722 (+)

Description Similar to FRS5: Protein FAR1-RELATED SEQUENCE 5

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g38180`	Putative transcription activator involved in regulating light control of development.	No verified direct reference in this release
`At1g76320`	Putative transcription activator involved in regulating light control of development.	No verified direct reference in this release
`At2g27110`	Putative transcription activator involved in regulating light control of development.	No verified direct reference in this release
`At1g10240`	Putative transcription activator involved in regulating light control of development.	No verified direct reference in this release
`At1g80010`	Putative transcription activator involved in regulating light control of development.	Arabidopsis FHY3/FAR1 gene family and distinct roles of its members in light control of Arabidopsis development.2004 · DOI: 10.1104/pp.104.052191

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_015931 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0005634 nucleus Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0008270 zinc ion binding Molecular Function

KEGG gene cross-reference

ath:AT1G10240

ath:AT1G76320

ath:AT1G80010

ath:AT2G27110

ath:AT4G38180

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.886

Rank 1 · LXL04_015931 · OH-1004

Cytoplasm0.157

Rank 2 · LXL04_015931 · OH-1004

Mitochondrion0.032

Rank 3 · LXL04_015931 · OH-1004

Cell membrane0.017

Rank 4 · LXL04_015931 · OH-1004

Extracellular0.012

Rank 5 · LXL04_015931 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03101.22FAR115-104 aa

PF21056.4ZSWIM1-3_RNaseH-like189-300 aa

PF10551.16MULE220-314 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_015931	`PF03101.22`	FAR1	15	104	5.1e-20	72.7
LXL04_015931	`PF21056.4`	ZSWIM1-3_RNaseH-like	189	300	7.1e-10	39.6
LXL04_015931	`PF10551.16`	MULE	220	314	2.5e-21	76.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SZL8`	Arabidopsis thaliana	Protein FAR1-RELATED SEQUENCE 5	29.550%	Swiss-Prot	weak database homology
`Q6NQJ7`	Arabidopsis thaliana	Protein FAR1-RELATED SEQUENCE 4	27.400%	Swiss-Prot	weak database homology
`Q9ZVC9`	Arabidopsis thaliana	Protein FAR1-RELATED SEQUENCE 3	26.958%	Swiss-Prot	weak database homology
`Q9SY66`	Arabidopsis thaliana	Protein FAR1-RELATED SEQUENCE 11	26.462%	Swiss-Prot	weak database homology
`Q9S793`	Arabidopsis thaliana	Protein FAR1-RELATED SEQUENCE 8	26.621%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card