TkA08G263300 | RubberDandelionOmics

Gene overview

TkA08G263300

Reference: TK1151 Chr: Chr08 Coordinates: 68661009-68661781 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

465 bp · TkA08G263300|TK1151|cDNA

GGCATAGTTTTACTCAGCCAGGAACTCATCGGCGCTCTTCTTGCTTGCTCTTTCTTTTGTCTGTTTCCAAACAGTTGTAGAGAGGCCAACAATCTTAATGTGATCAACTTTGACCATTTATTTGCGAGCCTATACGACAACTACAATGAAAAACAGGAAAACAAAATAAAATGCATCATTCATTATTTTGAGAGAATTTGTTCAAGTATGCCAGTAGGCAATGTCTCATTCGAGAGGAAAGTGCTTGCAGACAATCACAA...

CDS

Download CDS FASTA

465 bp · TkA08G263300|TK1151|CDS

GGCATAGTTTTACTCAGCCAGGAACTCATCGGCGCTCTTCTTGCTTGCTCTTTCTTTTGTCTGTTTCCAAACAGTTGTAGAGAGGCCAACAATCTTAATGTGATCAACTTTGACCATTTATTTGCGAGCCTATACGACAACTACAATGAAAAACAGGAAAACAAAATAAAATGCATCATTCATTATTTTGAGAGAATTTGTTCAAGTATGCCAGTAGGCAATGTCTCATTCGAGAGGAAAGTGCTTGCAGACAATCACAA...

Protein

Download Protein FASTA

155 aa · TkA08G263300|TK1151|PROTEIN

GIVLLSQELIGALLACSFFCLFPNSCREANNLNVINFDHLFASLYDNYNEKQENKIKCIIHYFERICSSMPVGNVSFERKVLADNHNLNYIPYPNAECWSKSMASLCLFEVCSLGLIEDTSKEALEVDFANKYLGGGALTKGCLQVCLFIISSIT

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G263300`
TK1151 ID	TkA08G263300
OH-1004 ID	LXL04_033419
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 94.194 / OH-1004 15.716 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G263300

Location Chr08:68661009-68661781 (-)

Description Similar to PARG1: Poly(ADP-ribose) glycohydrolase 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g31870`	Poly(ADP-ribose) synthesized after DNA damage is only present transiently and is rapidly degraded by poly(ADP-ribose) glycohydrolase (By similarity).	No verified direct reference in this release
`At2g31865`	Poly(ADP-ribose) synthesized after DNA damage is only present transiently and is rapidly degraded by poly(ADP-ribose) glycohydrolase.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_033419 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005975 carbohydrate metabolic process Biological Process

GO:0006282 regulation of DNA repair Biological Process

GO:0006970 response to osmotic stress Biological Process

GO:0006974 DNA damage response Biological Process

GO:0006979 response to oxidative stress Biological Process

GO:0009225 nucleotide-sugar metabolic process Biological Process

GO:0009408 response to heat Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0030576 Cajal body organization Biological Process

GO:0031507 heterochromatin formation Biological Process

GO:0036099 female germ-line stem cell population maintenance Biological Process

GO:0043484 regulation of RNA splicing Biological Process

KEGG gene cross-reference

ath:AT2G31865

ath:AT2G31870

dme:Dmel_CG2864

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.372

Rank 1 · TkA08G263300 · TK1151

Nucleus0.299

Rank 2 · TkA08G263300 · TK1151

Mitochondrion0.212

Rank 3 · TkA08G263300 · TK1151

Cell membrane0.108

Rank 4 · TkA08G263300 · TK1151

Endoplasmic reticulum0.094

Rank 5 · TkA08G263300 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF20811PARG_cat_N2-79 aa

PF27570TOF-1-like_helical41-70 aa

PF31127TMEM8_b-sand84-112 aa

PF05028PARG_cat_C98-145 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G263300	`PF20811`	PARG_cat_N	2	79	3.6e-26	92.4
TkA08G263300	`PF27570`	TOF-1-like_helical	41	70	0.051	14.6
TkA08G263300	`PF31127`	TMEM8_b-sand	84	112	0.2	12.3
TkA08G263300	`PF05028`	PARG_cat_C	98	145	1.3e-11	45.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SKB3`	Arabidopsis thaliana	sp\|Q9SKB3\|PARG1_ARATH Poly(ADP-ribose) glycohydrolase 1	65.500%	Swiss-Prot	High
`Q8VYA1`	Arabidopsis thaliana	sp\|Q8VYA1\|PARG2_ARATH Probable poly(ADP-ribose) glycohydrolase 2	56.600%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card