TkA08G263260 | RubberDandelionOmics

Gene overview

TkA08G263260

Reference: TK1151 Chr: Chr08 Coordinates: 68654827-68656731 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1395 bp · TkA08G263260|TK1151|cDNA

ATGGACAAGTCAGAAGTCATCACAAAGGCCACGGAACAATTAGACAAGTTCACATTAGGTTCTAATAGCTGGACCAACTTTGAGGTAGCAGCATGTAAAGCGGGGTATAAAGATATCATAAAGAAGGCGGGGCAGCAATATAAGCTAAAAGAAGTATGGAACAGTATGAGCAATGACGACAAAAAGTTGTTTGAAGCACCCAAACACACGATAAAGTGTAAAATCGCGTGTAGCATTCCTGAGTTCCAACAGAAGAAAAA...

CDS

Download CDS FASTA

1395 bp · TkA08G263260|TK1151|CDS

ATGGACAAGTCAGAAGTCATCACAAAGGCCACGGAACAATTAGACAAGTTCACATTAGGTTCTAATAGCTGGACCAACTTTGAGGTAGCAGCATGTAAAGCGGGGTATAAAGATATCATAAAGAAGGCGGGGCAGCAATATAAGCTAAAAGAAGTATGGAACAGTATGAGCAATGACGACAAAAAGTTGTTTGAAGCACCCAAACACACGATAAAGTGTAAAATCGCGTGTAGCATTCCTGAGTTCCAACAGAAGAAAAA...

Protein

Download Protein FASTA

464 aa · TkA08G263260|TK1151|PROTEIN

MDKSEVITKATEQLDKFTLGSNSWTNFEVAACKAGYKDIIKKAGQQYKLKEVWNSMSNDDKKLFEAPKHTIKCKIACSIPEFQQKKKKASEEMIRKFCSDKSNKVVSMKTVKEILKDKENHDDVKRAFAFLALRYIVCPPSREKLDAWTLNYVEDVNNLQTKPWATLAMQSLVKGIRTYQKQTGKSECYLGGSMVFLQLYYLNKVKCMAPENSILLEKKRTAQLLKFDEVNYASYIVSPCKHSVLCTPSSSRDQVVPHLY...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G263260`
TK1151 ID	TkA08G263260
OH-1004 ID	LXL04_019278
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	74.100
Protein coverage (%)	TK1151 68.966 / OH-1004 41.946 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA08G263260`
Location	Chr08:68654827-68656731 (+)
Description	Similar to MAIL1: Protein MAIN-LIKE 1
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_019278` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0010073 meristem maintenance Biological Process GO:0010082 regulation of root meristem growth Biological Process GO:0048507 meristem development Biological Process GO:0005634 nucleus Cellular Component GO:0005829 cytosol Cellular Component GO:0004722 protein serine/threonine phosphatase activity Molecular Function GO:0008483 transaminase activity Molecular Function GO:0046872 metal ion binding Molecular Function
KEGG gene cross-reference	ath:AT1G17930 ath:AT1G48120 ath:AT2G04865 ath:AT2G25010 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.885

Rank 1 · TkA08G263260 · TK1151

Cytoplasm0.190

Rank 2 · TkA08G263260 · TK1151

Mitochondrion0.036

Rank 3 · TkA08G263260 · TK1151

Cell membrane0.022

Rank 4 · TkA08G263260 · TK1151

Extracellular0.016

Rank 5 · TkA08G263260 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF09331DUF198572-174 aa

PF29561DUF856679-198 aa

PF10536PMD84-232 aa

PF07568HisKA_285-125 aa

PF00784MyTH4116-181 aa

PF09331DUF1985336-417 aa

PF13568OMP_b-brl_2407-447 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G263260	`PF09331`	DUF1985	72	174	0.12	13.1
TkA08G263260	`PF29561`	DUF8566	79	198	9.9e-23	81.7
TkA08G263260	`PF10536`	PMD	84	232	0.00016	21.7
TkA08G263260	`PF07568`	HisKA_2	85	125	0.095	13.5
TkA08G263260	`PF00784`	MyTH4	116	181	0.1	13.6
TkA08G263260	`PF09331`	DUF1985	336	417	0.12	13.1
TkA08G263260	`PF13568`	OMP_b-brl_2	407	447	0.011	16.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card