TkA08G263050 | RubberDandelionOmics

Gene overview

TkA08G263050

Reference: TK1151 Chr: Chr08 Coordinates: 68596351-68599168 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2138 bp · TkA08G263050|TK1151|cDNA

AATTAATTATATGCGAATTGGGCTCCATCTTCACATTCATCCATCGATGTTACCTCTCATGGCGGCCATTTCTCATTTTCCCTGTCCTGCCTAATTCTTAAAGCATTTTCTCTGGATTCATTCAATCTATTCTTTAAATTCATCCAACTTTCTCCCTTTCCACTTACAGTCTTCCGACCCACTTTCCATTAGGCATCTAGAGCTTTCTACAGATTCGAATATGGAAATTTGATGTTCTTCAAGTTTCTTGCTTACTAATT...

CDS

Download CDS FASTA

1683 bp · TkA08G263050|TK1151|CDS

ATGGAGAAACAGATTAGTTTTCGGATGGGAAAGATGGAAAACCAGCAGAGTTTTCGTGTTTCTGCTATGGAAAAGCAGAAGAGCTTTCGAATAGCCATGGGAAGACAGATGAGCTTCGGTGTTGACAGAAGGAAACCTAAAGATTCACCAGGAAAACGTGGGGATTCCATGCTTCATCTAGCTTCTAGAGGTGGTAATCTAGCAAAAGTCATAGAAATCTTTCAAAGCGTCGGCCTCGATGGATTATCGAAACAAAATCA...

Protein

Download Protein FASTA

560 aa · TkA08G263050|TK1151|PROTEIN

MEKQISFRMGKMENQQSFRVSAMEKQKSFRIAMGRQMSFGVDRRKPKDSPGKRGDSMLHLASRGGNLAKVIEIFQSVGLDGLSKQNQEGETPLYVAAENGHSHVVAQFLKHLDLQTASIAANNGYDPFHIAAKQGHLEVLKELLNSFPNLVMTTDSANSTALHTAAAQGHTDVVNLLLDADSNLAKIARNNGKTVLHTAARMGHLEVAKSVLTKDPSIGFRIDKKGQTALHMAVKGQNMDMVVELIKPDPTVLSLEDNKG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G263050`
TK1151 ID	TkA08G263050
OH-1004 ID	LXL04_033414
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.800
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G263050

Location Chr08:68596351-68599168 (+)

Description Similar to At5g02620: Ankyrin repeat-containing protein At5g02620

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g02620`	Ankyrin repeat-containing protein At5g02620.	No verified direct reference in this release
`At2g01680`	Ankyrin repeat-containing protein At2g01680.	No verified direct reference in this release
`At3g12360`	Involved in salt stress tolerance.	ITN1, a novel gene encoding an ankyrin-repeat protein that affects the ABA-mediated production of reactive oxygen species and is involved in salt-stress tolerance in Arabidopsis thaliana.2008 · DOI: 10.1111/j.1365-313x.2008.03614.x

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0837000`	Involved in salt stress tolerance.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_033414 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0007165 signal transduction Biological Process

GO:0009651 response to salt stress Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005886 plasma membrane Cellular Component

KEGG gene cross-reference

ath:AT2G01680

ath:AT3G12360

ath:AT5G02620

dosa:Os01g0837000

mmu:271144

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.847

Rank 1 · TkA08G263050 · TK1151

Cytoplasm0.090

Rank 2 · TkA08G263050 · TK1151

Endoplasmic reticulum0.063

Rank 3 · TkA08G263050 · TK1151

Nucleus0.061

Rank 4 · TkA08G263050 · TK1151

Lysosome / Vacuole0.027

Rank 5 · TkA08G263050 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13857Ank_552-68 aa

PF13637Ank_452-67 aa

PF12796Ank_253-110 aa

PF00023Ank54-68 aa

PF13606Ank_354-73 aa

PF12796Ank_258-146 aa

PF13637Ank_458-105 aa

PF24521Ank_KRIT158-115 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G263050	`PF13857`	Ank_5	52	68	3e-32	111.0
TkA08G263050	`PF13637`	Ank_4	52	67	5.2e-32	109.9
TkA08G263050	`PF12796`	Ank_2	53	110	6.2e-68	226.1
TkA08G263050	`PF00023`	Ank	54	68	5.4e-39	130.7
TkA08G263050	`PF13606`	Ank_3	54	73	7e-34	112.3
TkA08G263050	`PF12796`	Ank_2	58	146	6.2e-68	226.1
TkA08G263050	`PF13637`	Ank_4	58	105	5.2e-32	109.9
TkA08G263050	`PF24521`	Ank_KRIT1	58	115	1.1e-12	48.6
TkA08G263050	`PF13857`	Ank_5	85	105	3e-32	111.0
TkA08G263050	`PF13606`	Ank_3	88	111	7e-34	112.3
TkA08G263050	`PF00023`	Ank	89	110	5.4e-39	130.7
TkA08G263050	`PF24521`	Ank_KRIT1	90	199	1.1e-12	48.6
TkA08G263050	`PF12796`	Ank_2	122	182	6.2e-68	226.1
TkA08G263050	`PF13857`	Ank_5	122	144	3e-32	111.0
TkA08G263050	`PF00023`	Ank	123	145	5.4e-39	130.7
TkA08G263050	`PF13606`	Ank_3	123	147	7e-34	112.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q6AWW5`	Arabidopsis thaliana	sp\|Q6AWW5\|Y5262_ARATH Ankyrin repeat-containing protein At5g02620	51.000%	Swiss-Prot	Low
`Q9ZU96`	Arabidopsis thaliana	sp\|Q9ZU96\|Y2168_ARATH Ankyrin repeat-containing protein At2g01680	45.600%	Swiss-Prot	Low
`Q9C7A2`	Arabidopsis thaliana	sp\|Q9C7A2\|ITN1_ARATH Ankyrin repeat-containing protein ITN1	44.400%	Swiss-Prot	Low
`A2CIR5`	Oryza sativa subsp. japonica	sp\|A2CIR5\|NPR4_ORYSJ Ankyrin repeat-containing protein NPR4	42.000%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card