TkA08G260280 | RubberDandelionOmics

Gene overview

TkA08G260280

Reference: TK1151 Chr: Chr08 Coordinates: 67856215-67861939 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1313 bp · TkA08G260280|TK1151|cDNA

GTTTCCATTCTCTCAAACACGCAAACGGTCAGGCTTATGAGAAGAGAAAGAAAAGGAGATTGGAAACAGGTCGATGGCCGCTTGCAACAATATTTGGTTCTTCTTCTTGCTATTGTTTTAGGGTTTCTGATCATGGATCCTTTCGATATGAGTCCCGTTGGTGGACATAATTTCCCGACCTGTGAAAAATGATATTGCCCCGTATGACCAAGTGATGGAGAGTTGGCCCTTGACAATCTTAGCCGGTTAGGGCTTGGAAC...

CDS

Download CDS FASTA

552 bp · TkA08G260280|TK1151|CDS

ATGTTGGAAGGGGAGGCAACTGGAAGGCTGCTCAGATATGACCCTCCAACAAAGTCAACTCATGTTGTATTAAATGGCTTGGCTTTCCCAAATGGGGTTCAGTTGTCCAAGGACGAATCTTTTCTTTTGTTCACCGAGACTACAAACTGCAGGCTTATGAAATTATGGATAAAGGGTGAACAAAGCGGCAAAGTTGAACTTGTGGCAAACTTACCTGGTTTCCCAGACAACATAAGAATAAACGACCAAGGCCAGTTTTG...

Protein

Download Protein FASTA

183 aa · TkA08G260280|TK1151|PROTEIN

MLEGEATGRLLRYDPPTKSTHVVLNGLAFPNGVQLSKDESFLLFTETTNCRLMKLWIKGEQSGKVELVANLPGFPDNIRINDQGQFWVAIDCCRTKAQEILTNNPWMRSVYFRLPFQMRYLARIMGMKMYSVITLFDEQGKILDVLEDREGVVMKLVSEVREANGMLWIGTVAHNHIATLPYP

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G260280`
TK1151 ID	TkA08G260280
OH-1004 ID	LXL04_033433
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 44.963 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G260280

Location Chr08:67856215-67861939 (+)

Description Similar to SSL13: Protein STRICTOSIDINE SYNTHASE-LIKE 13

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g59530`	Required for the exine formation during pollen development.	No verified direct reference in this release
`At1g08470`	Protein STRICTOSIDINE SYNTHASE-LIKE 3.	No verified direct reference in this release
`At3g57030`	Protein STRICTOSIDINE SYNTHASE-LIKE 10.	No verified direct reference in this release
`At2g41300`	Protein STRICTOSIDINE SYNTHASE-LIKE 1.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_033433 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009555 pollen development Biological Process

GO:0010584 pollen exine formation Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005773 vacuole Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016787 hydrolase activity Molecular Function

KEGG gene cross-reference

ath:AT1G08470

ath:AT3G57010

ath:AT3G57020

ath:AT3G57030

ath:AT3G59530

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.627

Rank 1 · TkA08G260280 · TK1151

Cytoplasm0.179

Rank 2 · TkA08G260280 · TK1151

Cell membrane0.096

Rank 3 · TkA08G260280 · TK1151

Lysosome / Vacuole0.096

Rank 4 · TkA08G260280 · TK1151

Golgi apparatus0.072

Rank 5 · TkA08G260280 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03088Str_synth1-60 aa

PF08450SGL5-90 aa

PF01731Arylesterase18-104 aa

PF03088Str_synth74-98 aa

PF07494Reg_prop81-89 aa

PF16846Cep3107-162 aa

PF03088Str_synth139-159 aa

PF07494Reg_prop141-152 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G260280	`PF03088`	Str_synth	1	60	5e-21	75.3
TkA08G260280	`PF08450`	SGL	5	90	2.2e-10	41.3
TkA08G260280	`PF01731`	Arylesterase	18	104	0.00079	18.9
TkA08G260280	`PF03088`	Str_synth	74	98	5e-21	75.3
TkA08G260280	`PF07494`	Reg_prop	81	89	0.064	14.2
TkA08G260280	`PF16846`	Cep3	107	162	0.15	11.3
TkA08G260280	`PF03088`	Str_synth	139	159	5e-21	75.3
TkA08G260280	`PF07494`	Reg_prop	141	152	0.064	14.2
TkA08G260280	`PF08450`	SGL	162	175	2.2e-10	41.3
TkA08G260280	`PF07494`	Reg_prop	163	171	0.064	14.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M1B4`	Arabidopsis thaliana	sp\|Q9M1B4\|SSL13_ARATH Protein STRICTOSIDINE SYNTHASE-LIKE 13	72.700%	Swiss-Prot	High
`Q8VWF6`	Arabidopsis thaliana	sp\|Q8VWF6\|SSL3_ARATH Protein STRICTOSIDINE SYNTHASE-LIKE 3	43.800%	Swiss-Prot	Medium
`Q4V3D9`	Arabidopsis thaliana	sp\|Q4V3D9\|SSL10_ARATH Protein STRICTOSIDINE SYNTHASE-LIKE 10	43.700%	Swiss-Prot	Medium
`F4IJZ6`	Arabidopsis thaliana	sp\|F4IJZ6\|SSL1_ARATH Protein STRICTOSIDINE SYNTHASE-LIKE 1	39.200%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card