TkA08G258300 | RubberDandelionOmics

Gene overview

TkA08G258300

Reference: TK1151 Chr: Chr08 Coordinates: 67356666-67358038 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1221 bp · TkA08G258300|TK1151|cDNA

TCAATCACAACCACTCTTTCTCTCTCTCCCACCAACTCCTTATTTATTTCCCCACTCAATTCCCCATCATCAATCTCCCTTCTTTCTTTCTCGTTCTATTTCTCTTTCTCTTTCTCTCTCTTTCTTTGTTTATTTCATTCAGCAATGGTGCGATCGCCTTGCTGCGAAAAGGATCACACCAACAAAGGCGCATGGACTAAAGAAGAAGACGAGCGTCTGGTCTCCTACATCAACGCTCACGGCGAAGGCTCCTGGAGATC...

CDS

Download CDS FASTA

888 bp · TkA08G258300|TK1151|CDS

TCAATCACAACCACTCTTTCTCTCTCTCCCACCAACTCCTTATTTATTTCCCCACTCAATTCCCCATCATCAATCTCCCTTCTTTCTTTCTCGTTCTATTTCTCTTTCTCTTTCTCTCTCTTTCTTTGTTTATTTCATTCAGCAATGGTGCGATCGCCTTGCTGCGAAAAGGATCACACCAACAAAGGCGCATGGACTAAAGAAGAAGACGAGCGTCTGGTCTCCTACATCAACGCTCACGGCGAAGGCTCCTGGAGATC...

Protein

Download Protein FASTA

295 aa · TkA08G258300|TK1151|PROTEIN

SITTTLSLSPTNSLFISPLNSPSSISLLSFSFYFSFSFSLFLCLFHSAMVRSPCCEKDHTNKGAWTKEEDERLVSYINAHGEGSWRSLPKSAGLNRCGKSCRLRWINYLRPDLKRGNFTPQEDQLIVSLHAVLGNKWSMIASRLPGRTDNEIKNYWNTHIKRKLVVNHQTTTNVVKTVEEAPLAPPEHNSAQIVDTSTSGGGGGVSSSTTSGLSTEESIPVMNITHPPEINLELSIGLPMVSDLKPLVVVQPPVSAFSLY...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G258300`
TK1151 ID	TkA08G258300
OH-1004 ID	LXL04_033460
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	98.400
Protein coverage (%)	TK1151 83.729 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G258300

Location Chr08:67356666-67358038 (-)

Description Similar to MYB7: Transcription factor MYB7

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g34990`	Transcription factor MYB32.	No verified direct reference in this release
`At4g38620`	Transcription repressor involved in regulation of protection against UV.	No verified direct reference in this release
`At4g09460`	Transcription repressor MYB6.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_033460 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0010224 response to UV-B Biological Process

GO:0010597 green leaf volatile biosynthetic process Biological Process

GO:0045892 negative regulation of DNA-templated transcription Biological Process

GO:1900384 regulation of flavonol biosynthetic process Biological Process

GO:1903086 negative regulation of sinapate ester biosynthetic process Biological Process

GO:2000762 regulation of phenylpropanoid metabolic process Biological Process

GO:0005634 nucleus Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

GO:0003677 DNA binding Molecular Function

GO:0003700 DNA-binding transcription factor activity Molecular Function

KEGG gene cross-reference

ath:AT2G16720

ath:AT4G09460

ath:AT4G38620

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.940

Rank 1 · TkA08G258300 · TK1151

Cytoplasm0.126

Rank 2 · TkA08G258300 · TK1151

Cell membrane0.029

Rank 3 · TkA08G258300 · TK1151

Endoplasmic reticulum0.020

Rank 4 · TkA08G258300 · TK1151

Plastid0.014

Rank 5 · TkA08G258300 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF15963Myb_DNA-bind_759-81 aa

PF09111SLIDE59-88 aa

PF00249Myb_DNA-binding62-109 aa

PF23588HTH_CHD1_Hrp364-88 aa

PF13921Myb_DNA-bind_665-124 aa

PF08914Myb_Rap166-91 aa

PF09111SLIDE106-136 aa

PF00249Myb_DNA-binding115-159 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G258300	`PF15963`	Myb_DNA-bind_7	59	81	0.078	13.5
TkA08G258300	`PF09111`	SLIDE	59	88	0.11	13.3
TkA08G258300	`PF00249`	Myb_DNA-binding	62	109	8.4e-37	125.8
TkA08G258300	`PF23588`	HTH_CHD1_Hrp3	64	88	0.007	17.1
TkA08G258300	`PF13921`	Myb_DNA-bind_6	65	124	1.1e-21	77.5
TkA08G258300	`PF08914`	Myb_Rap1	66	91	0.19	12.8
TkA08G258300	`PF09111`	SLIDE	106	136	0.11	13.3
TkA08G258300	`PF00249`	Myb_DNA-binding	115	159	8.4e-37	125.8
TkA08G258300	`PF13921`	Myb_DNA-bind_6	118	163	1.1e-21	77.5
TkA08G258300	`PF08914`	Myb_Rap1	118	129	0.19	12.8
TkA08G258300	`PF15963`	Myb_DNA-bind_7	132	161	0.078	13.5
TkA08G258300	`PF23588`	HTH_CHD1_Hrp3	152	170	0.007	17.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O49608`	Arabidopsis thaliana	sp\|O49608\|MYB32_ARATH Transcription factor MYB32	83.800%	Swiss-Prot	Low
`Q9SZP1`	Arabidopsis thaliana	sp\|Q9SZP1\|MYB4_ARATH Transcription repressor MYB4	84.600%	Swiss-Prot	Low
`Q38851`	Arabidopsis thaliana	sp\|Q38851\|MYB6_ARATH Transcription repressor MYB6	74.600%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card