LXL04_033460 | RubberDandelionOmics

Gene overview

LXL04_033460

Reference: OH-1004 Chr: Chr07 Coordinates: 44375119-44376158 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

888 bp · LXL04_033460|LXL04_033460|OH1004|cDNA

TCAATCACAAccactctttctctctctcccACCAACTCCTTATTTATTTCCCCACTCAATTCCCCATCATCAATCTCCCTTCTTTCTTTCTCGTTCtatttctctttctctttctctctctttctttgTTTATTTCATTCAGCAATGGTGCGATCGCCTTGCTGCGAAAAGGATCACACCAACAAAGGCGCATGGACTAAAGAAGAAGACGAGCGTCTGGTCTCCTACATCAACGCTCACGGCGAAGGCTCCTGGAGATC...

CDS

Download CDS FASTA

744 bp · LXL04_033460|LXL04_033460|OH1004|CDS

ATGGTGCGATCGCCTTGCTGCGAAAAGGATCACACCAACAAAGGCGCATGGACTAAAGAAGAAGACGAGCGTCTGGTCTCCTACATCAACGCTCACGGCGAAGGCTCCTGGAGATCTCTACCTAAATCCGCCGGTTTGAATCGCTGCGGCAAAAGTTGTAGACTCCGATGGATTAATTACCTCCGGCCTGATCTTAAACGCGGCAATTTCACCCCACAAGAAGATCAACTCATAGTTAGCCTTCATGCAGTTCTCGGCAA...

Protein

Download Protein FASTA

247 aa · LXL04_033460|LXL04_033460|OH1004|PROTEIN

MVRSPCCEKDHTNKGAWTKEEDERLVSYINAHGEGSWRSLPKSAGLNRCGKSCRLRWINYLRPDLKRGNFTPQEDQLIVSLHAVLGNKWSMIASRLPGRTDNEIKNYWNTHIKRKLVVNHQTTTNVVETVEEAPLAPPEHNSAQIVDTSTSGGGGGVSSSTTSGLSTEESIPVMNIKHPPEINLELSIGLPMVSDLKPLVVLQPPVSAFSLYKEKIGDECGGGTLRRNDEHGLLYANEHSVGFSWFW

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_033460`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_033460

Location Chr07:44375119-44376158 (-)

Description Similar to MYB7: Transcription factor MYB7

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g16720`	Transcription factor involved in the negative regulation of flavonol biosynthesis.	AtMYB7, a new player in the regulation of UV-sunscreens in Arabidopsis thaliana.2014 · DOI: 10.1093/pcp/pct187 AtMyb7, a subgroup 4 R2R3 Myb, negatively regulates ABA-induced inhibition of seed germination by blocking the expression of the bZIP transcription factor ABI5.2015 · DOI: 10.1111/pce.12415
`At4g38620`	Transcription repressor involved in regulation of protection against UV.	No verified direct reference in this release
`At4g09460`	Transcription repressor MYB6.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_033460 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0010224 response to UV-B Biological Process

GO:0010597 green leaf volatile biosynthetic process Biological Process

GO:0045892 negative regulation of DNA-templated transcription Biological Process

GO:1900384 regulation of flavonol biosynthetic process Biological Process

GO:1903086 negative regulation of sinapate ester biosynthetic process Biological Process

GO:2000762 regulation of phenylpropanoid metabolic process Biological Process

GO:0005634 nucleus Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

GO:0003677 DNA binding Molecular Function

GO:0003700 DNA-binding transcription factor activity Molecular Function

KEGG gene cross-reference

ath:AT2G16720

ath:AT4G09460

ath:AT4G38620

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.960

Rank 1 · LXL04_033460 · OH-1004

Cytoplasm0.104

Rank 2 · LXL04_033460 · OH-1004

Cell membrane0.024

Rank 3 · LXL04_033460 · OH-1004

Endoplasmic reticulum0.013

Rank 4 · LXL04_033460 · OH-1004

Plastid0.011

Rank 5 · LXL04_033460 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00249.38Myb_DNA-binding14-61 aa

PF13921.13Myb_DNA-bind_617-76 aa

PF00249.38Myb_DNA-binding67-111 aa

PF13921.13Myb_DNA-bind_670-115 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_033460	`PF00249.38`	Myb_DNA-binding	14	61	4.9e-37	126.5
LXL04_033460	`PF13921.13`	Myb_DNA-bind_6	17	76	5.1e-22	78.5
LXL04_033460	`PF00249.38`	Myb_DNA-binding	67	111	4.9e-37	126.5
LXL04_033460	`PF13921.13`	Myb_DNA-bind_6	70	115	5.1e-22	78.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q42379`	Arabidopsis thaliana	Transcription factor MYB7	58.000%	Swiss-Prot	strong database homology
`Q9SZP1`	Arabidopsis thaliana	Transcription repressor MYB4	57.895%	Swiss-Prot	strong database homology
`Q38851`	Arabidopsis thaliana	Transcription repressor MYB6	55.122%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card