TkA08G251240 | RubberDandelionOmics

Gene overview

TkA08G251240

Reference: TK1151 Chr: Chr08 Coordinates: 65608965-65610149 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

890 bp · TkA08G251240|TK1151|cDNA

TTAAAGCATAAAAGTACCAACACTAAATGCAATAGTAAACATAAATATGGAAGATCATTTAGGGTTCTGGAGAAAAGGTCCATGGACTGCCGAAGAAGATCGGTTGCTTATTGACCATGTCAAACTGCATGGCGAAGGACGATGGAACTCTGTGGCCAAACTTACAGGGCTAAAAAGGAACGCAAAAAGTTGTAGGTTAAGGTGGGTGAACTATCTTAGGCCAGACTTAAAGAGAGGCAGAATTACCCCAAACGAGGAAA...

CDS

Download CDS FASTA

681 bp · TkA08G251240|TK1151|CDS

ATGGAAGATCATTTAGGGTTCTGGAGAAAAGGTCCATGGACTGCCGAAGAAGATCGGTTGCTTATTGACCATGTCAAACTGCATGGCGAAGGACGATGGAACTCTGTGGCCAAACTTACAGGGCTAAAAAGGAACGCAAAAAGTTGTAGGTTAAGGTGGGTGAACTATCTTAGGCCAGACTTAAAGAGAGGCAGAATTACCCCAAACGAGGAAAGGATTATTCTTGATTTGCATGCTCGATGGGGAAATAGGTGGTCAAC...

Protein

Download Protein FASTA

226 aa · TkA08G251240|TK1151|PROTEIN

MEDHLGFWRKGPWTAEEDRLLIDHVKLHGEGRWNSVAKLTGLKRNAKSCRLRWVNYLRPDLKRGRITPNEERIILDLHARWGNRWSTIARSLPGRTDNEIKNYWRTHFKKKGRMSSDDSVKLKARLLKRQKFQQEQLYLQKNEDMKRVLLLLEESDNKVTWRNQDMVNNEIQSVLYPMMFNDSQHVESSMISEDFSLWDGLWNLEDVYPATTKGCVQNLTMPTPIF

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G251240`
TK1151 ID	TkA08G251240
OH-1004 ID	LXL04_033334
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.100
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G251240

Location Chr08:65608965-65610149 (+)

Description Similar to MYB305: Myb-related protein 305

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g59780`	Transcription factor.	No verified direct reference in this release
`At3g46130`	Transcription factor.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0315400`	Transcription factor involved in abiotic stress responses.	A R2R3-type MYB gene, OsMYB2, is involved in salt, cold, and dehydration tolerance in rice.2012 · DOI: 10.1093/jxb/err431
`Os12g0567300`	Transcription factor.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_033334 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0007623 circadian rhythm Biological Process

GO:0009409 response to cold Biological Process

GO:0009585 red, far-red light phototransduction Biological Process

GO:0009740 gibberellic acid mediated signaling pathway Biological Process

GO:0009753 response to jasmonic acid Biological Process

GO:0009867 jasmonic acid mediated signaling pathway Biological Process

GO:0009909 regulation of flower development Biological Process

GO:0010468 regulation of gene expression Biological Process

GO:0010597 green leaf volatile biosynthetic process Biological Process

GO:0035865 cellular response to potassium ion Biological Process

KEGG gene cross-reference

ath:AT3G27810

ath:AT5G59780

dosa:Os03g0315400

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.957

Rank 1 · TkA08G251240 · TK1151

Cytoplasm0.128

Rank 2 · TkA08G251240 · TK1151

Cell membrane0.017

Rank 3 · TkA08G251240 · TK1151

Mitochondrion0.015

Rank 4 · TkA08G251240 · TK1151

Endoplasmic reticulum0.007

Rank 5 · TkA08G251240 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00249Myb_DNA-binding10-57 aa

PF23082Myb_DNA-binding_212-43 aa

PF13921Myb_DNA-bind_613-71 aa

PF00249Myb_DNA-binding63-107 aa

PF13921Myb_DNA-bind_667-111 aa

PF23082Myb_DNA-binding_283-114 aa

PF13775DUF4171109-158 aa

PF23082Myb_DNA-binding_2114-146 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G251240	`PF00249`	Myb_DNA-binding	10	57	1e-35	122.3
TkA08G251240	`PF23082`	Myb_DNA-binding_2	12	43	0.047	14.5
TkA08G251240	`PF13921`	Myb_DNA-bind_6	13	71	5.3e-22	78.5
TkA08G251240	`PF00249`	Myb_DNA-binding	63	107	1e-35	122.3
TkA08G251240	`PF13921`	Myb_DNA-bind_6	67	111	5.3e-22	78.5
TkA08G251240	`PF23082`	Myb_DNA-binding_2	83	114	0.047	14.5
TkA08G251240	`PF13775`	DUF4171	109	158	0.27	12.7
TkA08G251240	`PF23082`	Myb_DNA-binding_2	114	146	0.047	14.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q4JL84`	Arabidopsis thaliana	sp\|Q4JL84\|MYB59_ARATH Transcription factor MYB59	70.200%	Swiss-Prot	Low
`Q9LX82`	Arabidopsis thaliana	sp\|Q9LX82\|MYB48_ARATH Transcription factor MYB48	69.900%	Swiss-Prot	Low
`Q10MB4`	Oryza sativa subsp. japonica	sp\|Q10MB4\|MYB2_ORYSJ Transcription factor MYB2	69.500%	Swiss-Prot	Low
`Q4JL76`	Oryza sativa subsp. japonica	sp\|Q4JL76\|MYBA2_ORYSJ Myb-related protein MYBAS2	71.800%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card