TkA08G249420 | RubberDandelionOmics

Gene overview

TkA08G249420

Reference: TK1151 Chr: Chr08 Coordinates: 65130081-65133010 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2101 bp · TkA08G249420|TK1151|cDNA

GTTTGGCCTAAACCCTTCATAGTGTTTTGGACTTTTTGTCGATATTCATCTTTTCAGCGTTTAGCCTTGCAAATCGCTGTGTCTTCGCAAGAACTCAGAAGTCCCCTTCTACAAACCCTAATCGTTTCCGTTCAATCCAGATACCAGAAAACCTACCTCCCCTCCAATGGAACCGGAGCAGCAGCCATCGCAAGAGACCAGCAAAAAAGCGGCAAAAAAGGAGGCTGCCAAGGCAGAAAAACTTCGCCGCCGTCAGGAAG...

CDS

Download CDS FASTA

1449 bp · TkA08G249420|TK1151|CDS

ATGGAACCGGAGCAGCAGCCATCGCAAGAGACCAGCAAAAAAGCGGCAAAAAAGGAGGCTGCCAAGGCAGAAAAACTTCGCCGCCGTCAGGAAGCCGCCGCCGCCTCTGCCGCCGTTGCTGGTGTTTCCATCGAGGGTCCTGATCCTCTTGCCGCAAACTATGGAGACATTCCCATCAAAGATCTTCAGTCGAAGTCTATCTCTGGTCGTGTGTGGACCACCGTTAGCTCTCTTACAGAGGAACTCAAAGACCGCACGGT...

Protein

Download Protein FASTA

482 aa · TkA08G249420|TK1151|PROTEIN

MEPEQQPSQETSKKAAKKEAAKAEKLRRRQEAAAASAAVAGVSIEGPDPLAANYGDIPIKDLQSKSISGRVWTTVSSLTEELKDRTVLIRGRAQAIRAVGKKMAFFTVREKGYTVQCVLTVSPDLVSAQMVKYATGISKESFVDIEGVVTVPPEAIKGASQQVEVQVRKIHCVNRAAAVLPINVEDAARSEVEIEKALEAGEQLVRVNQDTRLNYRILDLRTPANQAIYRLEFQVSNLFKEFLVYEDFIEIYTPKLIAGS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G249420`
TK1151 ID	TkA08G249420
OH-1004 ID	LXL04_033304
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	90.300
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G249420

Location Chr08:65130081-65133010 (-)

Description Similar to IBI1: Aspartate--tRNA ligase 2, cytoplasmic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g31180`	Catalyzes the specific attachment of an amino acid to its cognate tRNA in a 2 step reaction: the amino acid (AA) is first activated by ATP to form AA-AMP and then transferred to the acceptor end of the tRNA (By similarity).	Plant perception of β-aminobutyric acid is mediated by an aspartyl-tRNA synthetase.2014 · DOI: 10.1038/nchembio.1520
`At4g26870`	Catalyzes the specific attachment of an amino acid to its cognate tRNA in a 2 step reaction: the amino acid (AA) is first activated by ATP to form AA-AMP and then transferred to the acceptor end of the tRNA.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_033304 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006422 aspartyl-tRNA aminoacylation Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0017101 aminoacyl-tRNA synthetase multienzyme complex Cellular Component

GO:0003677 DNA binding Molecular Function

GO:0003723 RNA binding Molecular Function

GO:0004815 aspartate-tRNA ligase activity Molecular Function

GO:0005524 ATP binding Molecular Function

KEGG gene cross-reference

ath:AT4G26870

ath:AT4G31180

bta:510162

mmu:226414

rno:116483

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.630

Rank 1 · TkA08G249420 · TK1151

Nucleus0.295

Rank 2 · TkA08G249420 · TK1151

Mitochondrion0.159

Rank 3 · TkA08G249420 · TK1151

Cell membrane0.041

Rank 4 · TkA08G249420 · TK1151

Peroxisome0.036

Rank 5 · TkA08G249420 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01336tRNA_anti-codon87-171 aa

PF00152tRNA-synt_2208-358 aa

PF01409tRNA-synt_2d297-347 aa

PF00152tRNA-synt_2358-476 aa

PF01409tRNA-synt_2d449-470 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G249420	`PF01336`	tRNA_anti-codon	87	171	2.8e-08	34.3
TkA08G249420	`PF00152`	tRNA-synt_2	208	358	5.3e-69	233.4
TkA08G249420	`PF01409`	tRNA-synt_2d	297	347	0.0012	19.2
TkA08G249420	`PF00152`	tRNA-synt_2	358	476	5.3e-69	233.4
TkA08G249420	`PF01409`	tRNA-synt_2d	449	470	0.0012	19.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M084`	Arabidopsis thaliana	sp\|Q9M084\|SYDC2_ARATH Aspartate--tRNA ligase 2, cytoplasmic	59.100%	Swiss-Prot	High
`Q8H104`	Arabidopsis thaliana	sp\|Q8H104\|SYDC1_ARATH Aspartate--tRNA ligase 1, cytoplasmic	56.100%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card