TkA08G249110 | RubberDandelionOmics

Gene overview

TkA08G249110

Reference: TK1151 Chr: Chr08 Coordinates: 65048333-65052531 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2195 bp · TkA08G249110|TK1151|cDNA

TTTAACTGTTTATCGAAGTATATACTTTTACCAAACTTGCCACGTTACGGACTTGCGGGTTGAAATTTTGGGTAAACAGATGGTGACTCACACCATGCTAGAACCCTGGAAACCTCTCTTCATGATCACTCGCATGTGCCCATCATTAACCCCCCAATTTAGAATTGGAATCCTTTTGATTCTCTCCTTGGTTTTCTGTAAATCTTGCTTCGATTAACTAAATTATACTCCAGTATACGCTCATTGATCATCAGCATCAT...

CDS

Download CDS FASTA

1569 bp · TkA08G249110|TK1151|CDS

ATGAGGAGGCCTGGAGAAGGAATGATGTTGAAGAGACCGTATTATAATCGACACCAGCTGAAGCAAGTTAAGGGACTGTTGGGCAGATTCAGGATTGTGGTTTTTTTAATTGTTATTCTGATCATCTACTTCATCGTCATCTCCACCAGCAAGACCAATTACTTATCGCCAGAATCCCCATCTGAGATTAGTGTGGAGAAACTATGGAATCCTGCTGATTCTGGTGGCTGGATACCATCATCCACTCCTAGATCTAATTG...

Protein

Download Protein FASTA

522 aa · TkA08G249110|TK1151|PROTEIN

MRRPGEGMMLKRPYYNRHQLKQVKGLLGRFRIVVFLIVILIIYFIVISTSKTNYLSPESPSEISVEKLWNPADSGGWIPSSTPRSNWPPPPKETNGYLRVRCNGGLNQQRTAICNAVLAARIMNATLVLPELDTNSYWHDDSGFQGLYDVDYFIKSLRFDVRIVESIPEIRKNGKTKKIKAFQIRPPRDAGIDWYTSVALEKMKEHGAIYLTPFSHRLAEEINNPEYQRLRCRVNYHALRFKPHIMQLSQSIVAKLRSQG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G249110`
TK1151 ID	TkA08G249110
OH-1004 ID	LXL04_033293
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	96.300
Protein coverage (%)	TK1151 99.617 / OH-1004 98.349 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G249110

Location Chr08:65048333-65052531 (-)

Description Similar to OFUT1: O-fucosyltransferase 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g04910`	O-fucosyltransferase 1.	No verified direct reference in this release
`At5g35570`	O-fucosyltransferase 35.	No verified direct reference in this release
`At4g16650`	O-fucosyltransferase 29.	No verified direct reference in this release
`At4g24530`	O-fucosyltransferase 31.	No verified direct reference in this release
`At1g22460`	O-fucosyltransferase 7.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_033293 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006004 fucose metabolic process Biological Process

GO:0045489 pectin biosynthetic process Biological Process

GO:0071555 cell wall organization Biological Process

GO:0000137 Golgi cis cisterna Cellular Component

GO:0000138 Golgi trans cisterna Cellular Component

GO:0000139 Golgi membrane Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005768 endosome Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005802 trans-Golgi network Cellular Component

KEGG gene cross-reference

ath:AT1G04910

ath:AT1G14020

ath:AT1G22460

ath:AT4G24530

ath:AT5G65470

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Golgi apparatus0.832

Rank 1 · TkA08G249110 · TK1151

Endoplasmic reticulum0.064

Rank 2 · TkA08G249110 · TK1151

Cell membrane0.059

Rank 3 · TkA08G249110 · TK1151

Cytoplasm0.039

Rank 4 · TkA08G249110 · TK1151

Extracellular0.039

Rank 5 · TkA08G249110 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13800Sigma_reg_N29-59 aa

PF10250O-FucT97-417 aa

PF01323DSBA210-275 aa

PF13800Sigma_reg_N280-314 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G249110	`PF13800`	Sigma_reg_N	29	59	0.078	13.9
TkA08G249110	`PF10250`	O-FucT	97	417	3.1e-90	304.0
TkA08G249110	`PF01323`	DSBA	210	275	0.13	12.8
TkA08G249110	`PF13800`	Sigma_reg_N	280	314	0.078	13.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8W486`	Arabidopsis thaliana	sp\|Q8W486\|OFUT1_ARATH O-fucosyltransferase 1	74.100%	Swiss-Prot	High
`Q94BY4`	Arabidopsis thaliana	sp\|Q94BY4\|OFT35_ARATH O-fucosyltransferase 35	39.800%	Swiss-Prot	Medium
`Q8LPF8`	Arabidopsis thaliana	sp\|Q8LPF8\|OFT29_ARATH O-fucosyltransferase 29	40.700%	Swiss-Prot	Medium
`Q7Y030`	Arabidopsis thaliana	sp\|Q7Y030\|OFT31_ARATH O-fucosyltransferase 31	37.400%	Swiss-Prot	Medium
`B7ZWR7`	Arabidopsis thaliana	sp\|B7ZWR7\|OFUT7_ARATH O-fucosyltransferase 7	35.800%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card