TkA08G242120 | RubberDandelionOmics

Gene overview

TkA08G242120

Reference: TK1151 Chr: Chr08 Coordinates: 63181559-63183364 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1532 bp · TkA08G242120|TK1151|cDNA

ACACTTTGGCAATAACAGAGTATATGGAGAAATCCGGTTGTTGCCCCGACGGAATATTTCGATCACTCCGGCCACCACTAGTCCTCCCAACAGACCCCAACACATCAATGACATCCTTCCTTTTCCGTAACACTTCATCGTACCCAAACAAACCTGCCTTAATCGACTCCTATTCCGGCGACACCCTCACTTTCTCCGAATTCAAAACCACCGTCGCCAAGTTCTCTTACGCCCTAAACAACCAATTAGGCATCACCAAG...

CDS

Download CDS FASTA

1509 bp · TkA08G242120|TK1151|CDS

ATGGAGAAATCCGGTTGTTGCCCCGACGGAATATTTCGATCACTCCGGCCACCACTAGTCCTCCCAACAGACCCCAACACATCAATGACATCCTTCCTTTTCCGTAACACTTCATCGTACCCAAACAAACCTGCCTTAATCGACTCCTATTCCGGCGACACCCTCACTTTCTCCGAATTCAAAACCACCGTCGCCAAGTTCTCTTACGCCCTAAACAACCAATTAGGCATCACCAAGAACGACGTAGTTCTCATTTTCGT...

Protein

Download Protein FASTA

503 aa · TkA08G242120|TK1151|PROTEIN

MEKSGCCPDGIFRSLRPPLVLPTDPNTSMTSFLFRNTSSYPNKPALIDSYSGDTLTFSEFKTTVAKFSYALNNQLGITKNDVVLIFVPNSIQYPICSYSVIALGAIVTTVNPQYTVRELSKQIEDSNPKLIITVQELYPKVENFGFPIVFLGQESSNKGCFSYKDLILKSGSVSELPKVSIRGHDTAGLLYSSGTTGVSKGVILSHNNFIAASQMATSDQKVMGEKDYIHLCFLPMFHISGFAVILYNQLQEGNTDVSMG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G242120`
TK1151 ID	TkA08G242120
OH-1004 ID	LXL04_004549
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	83.700
Protein coverage (%)	TK1151 100.000 / OH-1004 82.702 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G242120

Location Chr08:63181559-63183364 (-)

Description Similar to 4CLL7: 4-coumarate--CoA ligase-like 7

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g05160`	Contributes to jasmonic acid biosynthesis by initiating the beta-oxidative chain shortening of its precursors.	A new type of peroxisomal acyl-coenzyme A synthetase from Arabidopsis thaliana has the catalytic capacity to activate biosynthetic precursors of jasmonic acid.2005 · DOI: 10.1074/jbc.m413578200

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0152400`	Carboxylate--CoA ligase that may use 4-coumarate as substrate.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_004549 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009695 jasmonic acid biosynthetic process Biological Process

GO:0009698 phenylpropanoid metabolic process Biological Process

GO:0031408 oxylipin biosynthetic process Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005777 peroxisome Cellular Component

GO:0005829 cytosol Cellular Component

GO:0004321 fatty-acyl-CoA synthase activity Molecular Function

GO:0004467 long-chain fatty acid-CoA ligase activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0016207 4-coumarate-CoA ligase activity Molecular Function

GO:0016405 CoA-ligase activity Molecular Function

GO:0106290 trans-cinnamate-CoA ligase activity Molecular Function

KEGG gene cross-reference

ath:AT4G05160

dosa:Os03g0152400

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.392

Rank 1 · TkA08G242120 · TK1151

Peroxisome0.343

Rank 2 · TkA08G242120 · TK1151

Nucleus0.106

Rank 3 · TkA08G242120 · TK1151

Mitochondrion0.093

Rank 4 · TkA08G242120 · TK1151

Endoplasmic reticulum0.079

Rank 5 · TkA08G242120 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00501AMP-binding35-399 aa

PF18564Glyco_hydro_5_C56-109 aa

PF13193AMP-binding_C311-328 aa

PF13193AMP-binding_C450-499 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G242120	`PF00501`	AMP-binding	35	399	4.5e-82	276.6
TkA08G242120	`PF18564`	Glyco_hydro_5_C	56	109	0.28	12.4
TkA08G242120	`PF13193`	AMP-binding_C	311	328	1.4e-07	33.0
TkA08G242120	`PF13193`	AMP-binding_C	450	499	1.4e-07	33.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M0X9`	Arabidopsis thaliana	sp\|Q9M0X9\|4CLL7_ARATH 4-coumarate--CoA ligase-like 7	61.800%	Swiss-Prot	High
`Q0DV32`	Oryza sativa subsp. japonica	sp\|Q0DV32\|4CLL1_ORYSJ 4-coumarate--CoA ligase-like 1	51.500%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card