RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA08G240970
Reference: TK1151 Chr: Chr08 Coordinates: 62839250-62842934 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

2260 bp · TkA08G240970|TK1151|cDNA

AAAAAAGTGCATGTTTGACCGATACAAGATTGACATGGTTTATTCTATACCACACGCCTACCCTAATTCATGAGTCTATCTCCCAATTCGGTTGATCCGAATAAACATTGATTTGTGTTTTGGGGCTGCGCGATCGCGATAATCGAAGGGAATTCAAGAATCGATTAAACCTGTTAAAAGGTTCTCTGTTGTGGTTGTTTTTGCGACTTTGCGTAGACCGACGCCATGATCCTATAAATTAAAACCCTCCCCACAAATCG...

CDS

Download CDS FASTA

1758 bp · TkA08G240970|TK1151|CDS

ATGGATTCGGAAGATGATATGCACGATGCGAACGATGTTGATTCTTATGAAGAATATTACTTTAGCGGTGATGCGATGGACAGCGATATGGAGGATGATGATGCTGTGTTTGAGTATTTGGATAACGCTTCTGATGGTTCTGACGATGTAGTTAGTCGGCAACAGAAGAATTATACAATCTTGAAGGAAGATGACATAAGCCAACGCCAAGAAGATGATATCACTACAATTTGTTCAGTTCTATCAATCTCAAGAGACTC...

Protein

Download Protein FASTA

585 aa · TkA08G240970|TK1151|PROTEIN

MDSEDDMHDANDVDSYEEYYFSGDAMDSDMEDDDAVFEYLDNASDGSDDVVSRQQKNYTILKEDDISQRQEDDITTICSVLSISRDSACMLLRRYNWNVTNVHEYWFANEDEVRKAVGLMDNTNIKPPKSGELHCGICFESYPLDNISSAACGHPFCNTCWTAYISTSINDGPGCLTLRCPIPSCGAAVGVDMVNMLTSEEDKKKYRRYLLRSYIEDSKKTKWCPAPGCDCAIEFEMGGGSYDVTCYCSYSFCWNCTEEA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA08G240970
TK1151 IDTkA08G240970
OH-1004 IDLXL04_033206
Relationship / confidenceRbh High Identity Coverage Synteny / Strict
Protein identity (%)98.800
Protein coverage (%)TK1151 100.000 / OH-1004 100.000
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA08G240970
LocationChr08:62839250-62842934 (+)
DescriptionSimilar to ARI7: Probable E3 ubiquitin-protein ligase ARI7
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At1g65430 Might act as an E3 ubiquitin-protein ligase, or as part of E3 complex, which accepts ubiquitin from specific E2 ubiquitin-conjugating enzymes and then transfers it to substrates. No verified direct reference in this release
At2g31510 Might act as an E3 ubiquitin-protein ligase, or as part of E3 complex, which accepts ubiquitin from specific E2 ubiquitin-conjugating enzymes and then transfers it to substrates. No verified direct reference in this release
At1g05890 Might act as an E3 ubiquitin-protein ligase, or as part of E3 complex, which accepts ubiquitin from specific E2 ubiquitin-conjugating enzymes and then transfers it to substrates. No verified direct reference in this release
At1g63760 Might act as an E3 ubiquitin-protein ligase, or as part of E3 complex, which accepts ubiquitin from specific E2 ubiquitin-conjugating enzymes and then transfers it to substrates. No verified direct reference in this release
At2g31770 Might act as an E3 ubiquitin-protein ligase, or as part of E3 complex, which accepts ubiquitin from specific E2 ubiquitin-conjugating enzymes and then transfers it to substrates. No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_033206 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006511 ubiquitin-dependent protein catabolic process Biological Process
GO:0016567 protein ubiquitination Biological Process
GO:0000151 ubiquitin ligase complex Cellular Component
GO:0005634 nucleus Cellular Component
GO:0005737 cytoplasm Cellular Component
GO:0004842 ubiquitin-protein transferase activity Molecular Function
GO:0008270 zinc ion binding Molecular Function
GO:0031624 ubiquitin conjugating enzyme binding Molecular Function
GO:0061630 ubiquitin protein ligase activity Molecular Function
KEGG gene cross-reference
ath:AT1G05890
ath:AT1G65430
ath:AT2G31510
ath:AT2G31770
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.563
Rank 1 · TkA08G240970 · TK1151
Cytoplasm0.461
Rank 2 · TkA08G240970 · TK1151
Cell membrane0.061
Rank 3 · TkA08G240970 · TK1151
Mitochondrion0.047
Rank 4 · TkA08G240970 · TK1151
Endoplasmic reticulum0.037
Rank 5 · TkA08G240970 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF09077Phage-MuB_C65-92 aa
PF21235UBA_ARI168-104 aa
PF26000UBA_ARIH2_N70-104 aa
PF14634zf-RING_5134-181 aa
PF13639zf-RING_2134-180 aa
PF13923zf-C3HC4_2135-168 aa
PF00097zf-C3HC4135-171 aa
PF24921RING_XB3-XBAT31135-181 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA08G240970PF09077Phage-MuB_C65920.3511.5
TkA08G240970PF21235UBA_ARI1681042.7e-0834.1
TkA08G240970PF26000UBA_ARIH2_N701040.08713.5
TkA08G240970PF14634zf-RING_51341810.002518.4
TkA08G240970PF13639zf-RING_21341800.01116.7
TkA08G240970PF13923zf-C3HC4_21351680.0003321.1
TkA08G240970PF00097zf-C3HC41351710.001718.9
TkA08G240970PF24921RING_XB3-XBAT311351810.002818.4
TkA08G240970PF13445zf-RING_UBOX1351610.005417.4
TkA08G240970PF01485IBR1501611.8e-2073.5
TkA08G240970PF22605IBR_21501639.9e-1348.7
TkA08G240970PF26200Rcat_RNF2161501620.003818.5
TkA08G240970PF22191IBR_11511643.4e-1556.4
TkA08G240970PF21363TRAF3_RING1511690.04614.1
TkA08G240970PF26200Rcat_RNF2161561800.003818.5
TkA08G240970PF00641Zn_ribbon_RanBP1571620.005916.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q8W468Arabidopsis thalianasp|Q8W468|ARI8_ARATH Probable E3 ubiquitin-protein ligase ARI864.700%Swiss-ProtHigh
Q84RR0Arabidopsis thalianasp|Q84RR0|ARI7_ARATH Probable E3 ubiquitin-protein ligase ARI767.500%Swiss-ProtHigh
Q8L829Arabidopsis thalianasp|Q8L829|ARI5_ARATH Probable E3 ubiquitin-protein ligase ARI564.400%Swiss-ProtHigh
P0C8K8Arabidopsis thalianasp|P0C8K8|ARI6_ARATH Putative E3 ubiquitin-protein ligase ARI661.100%Swiss-ProtHigh
Q9SKC3Arabidopsis thalianasp|Q9SKC3|ARI9_ARATH Probable E3 ubiquitin-protein ligase ARI956.000%Swiss-ProtHigh

JBrowse

View in Genome Browser