LXL04_033206 | RubberDandelionOmics

Gene overview

LXL04_033206

Reference: OH-1004 Chr: Chr07 Coordinates: 38277099-38280280 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1758 bp · LXL04_033206|LXL04_033206|OH1004|cDNA

ATGGATTCGGAAGATGATATGCACGATGCGAACGATGTTGATTCTTATGAAGAATATTACTTTAGCGGTGATGCGATGGACAGCGATATGGAGGATGATGATGCTGTGTTTGAGTATTTGGATAACGCTTCTGATGGTTCTGATGATGTAGTTAGTCGGCAACAGAAGAATTATACAATCTTGAAGGAAGATGACATAAGCCAACGCCAAGAAGATGATATCACTACAATTTGTTCAGTTCTATCAATCTCAAGAGACTC...

CDS

Download CDS FASTA

1758 bp · LXL04_033206|LXL04_033206|OH1004|CDS

ATGGATTCGGAAGATGATATGCACGATGCGAACGATGTTGATTCTTATGAAGAATATTACTTTAGCGGTGATGCGATGGACAGCGATATGGAGGATGATGATGCTGTGTTTGAGTATTTGGATAACGCTTCTGATGGTTCTGATGATGTAGTTAGTCGGCAACAGAAGAATTATACAATCTTGAAGGAAGATGACATAAGCCAACGCCAAGAAGATGATATCACTACAATTTGTTCAGTTCTATCAATCTCAAGAGACTC...

Protein

Download Protein FASTA

585 aa · LXL04_033206|LXL04_033206|OH1004|PROTEIN

MDSEDDMHDANDVDSYEEYYFSGDAMDSDMEDDDAVFEYLDNASDGSDDVVSRQQKNYTILKEDDISQRQEDDITTICSVLSISRDSACMLLRRYNWNVTNVHEYWFANEDEVRKAVGLMDNTNIKPPKSGELHCGICFESYPLDNISSAACGHPFCNTCWTAYISTSINDGPGCLTLRCPIPSCGAAVGVDMVNMLTSEEDKKKYRRYLLRSYIEDSKKTKWCPAPGCDCAIEFEMGGGSYDVTCYCSYSFCWNCTEEA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_033206`
TK1151 ID	TkA08G240970
OH-1004 ID	LXL04_033206
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.800
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_033206

Location Chr07:38277099-38280280 (+)

Description Similar to ARI7: Probable E3 ubiquitin-protein ligase ARI7

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g31510`	Might act as an E3 ubiquitin-protein ligase, or as part of E3 complex, which accepts ubiquitin from specific E2 ubiquitin-conjugating enzymes and then transfers it to substrates.	No verified direct reference in this release
`At1g65430`	Might act as an E3 ubiquitin-protein ligase, or as part of E3 complex, which accepts ubiquitin from specific E2 ubiquitin-conjugating enzymes and then transfers it to substrates.	No verified direct reference in this release
`At1g05890`	Might act as an E3 ubiquitin-protein ligase, or as part of E3 complex, which accepts ubiquitin from specific E2 ubiquitin-conjugating enzymes and then transfers it to substrates.	No verified direct reference in this release
`At1g63760`	Might act as an E3 ubiquitin-protein ligase, or as part of E3 complex, which accepts ubiquitin from specific E2 ubiquitin-conjugating enzymes and then transfers it to substrates.	No verified direct reference in this release
`At2g31770`	Might act as an E3 ubiquitin-protein ligase, or as part of E3 complex, which accepts ubiquitin from specific E2 ubiquitin-conjugating enzymes and then transfers it to substrates.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_033206 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006511 ubiquitin-dependent protein catabolic process Biological Process

GO:0016567 protein ubiquitination Biological Process

GO:0000151 ubiquitin ligase complex Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0004842 ubiquitin-protein transferase activity Molecular Function

GO:0008270 zinc ion binding Molecular Function

GO:0031624 ubiquitin conjugating enzyme binding Molecular Function

GO:0061630 ubiquitin protein ligase activity Molecular Function

KEGG gene cross-reference

ath:AT1G05890

ath:AT1G65430

ath:AT2G31510

ath:AT2G31770

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.544

Rank 1 · LXL04_033206 · OH-1004

Cytoplasm0.476

Rank 2 · LXL04_033206 · OH-1004

Cell membrane0.063

Rank 3 · LXL04_033206 · OH-1004

Mitochondrion0.048

Rank 4 · LXL04_033206 · OH-1004

Endoplasmic reticulum0.040

Rank 5 · LXL04_033206 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF21235.5UBA_ARI168-104 aa

PF01485.28IBR204-266 aa

PF01485.28IBR283-330 aa

PF22191.3IBR_1288-328 aa

PF22605.3IBR_2289-328 aa

PF19422.5Ariadne367-514 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_033206	`PF21235.5`	UBA_ARI1	68	104	2.7e-08	34.1
LXL04_033206	`PF01485.28`	IBR	204	266	1.8e-20	73.5
LXL04_033206	`PF01485.28`	IBR	283	330	1.8e-20	73.5
LXL04_033206	`PF22191.3`	IBR_1	288	328	3.4e-15	56.4
LXL04_033206	`PF22605.3`	IBR_2	289	328	9.9e-13	48.7
LXL04_033206	`PF19422.5`	Ariadne	367	514	4.1e-06	27.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q84RR0`	Arabidopsis thaliana	Probable E3 ubiquitin-protein ligase ARI7	68.036%	Swiss-Prot	strong database homology
`Q8W468`	Arabidopsis thaliana	Probable E3 ubiquitin-protein ligase ARI8	65.017%	Swiss-Prot	strong database homology
`Q8L829`	Arabidopsis thaliana	Probable E3 ubiquitin-protein ligase ARI5	64.912%	Swiss-Prot	strong database homology
`P0C8K8`	Arabidopsis thaliana	Putative E3 ubiquitin-protein ligase ARI6	60.521%	Swiss-Prot	strong database homology
`Q9SKC3`	Arabidopsis thaliana	Probable E3 ubiquitin-protein ligase ARI9	54.971%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card