TkA08G234890 | RubberDandelionOmics

Gene overview

TkA08G234890

Reference: TK1151 Chr: Chr08 Coordinates: 61234987-61236723 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

420 bp · TkA08G234890|TK1151|cDNA

ATGTTCAAGCATCTAACTTGTCTTGAATTAGAAGACAACAAGCATGTGAAGCCCGATTTCTCAATTACATATCTCAAAGGCAATGAAACTTCTTTGAATGATAGAAGTTCAAGGTCACATCAAATAATCAGATTGACTATTGAGAGTAGCCATCTAGAAGAATCAGGACGTGTGAAATCCCTCTGTGGTGGGAAAAACATTGGTCATGTACCATATAGAGATTCAAAACTGACAAGAATATTGCAGTCATCACTTGGAGG...

CDS

Download CDS FASTA

420 bp · TkA08G234890|TK1151|CDS

ATGTTCAAGCATCTAACTTGTCTTGAATTAGAAGACAACAAGCATGTGAAGCCCGATTTCTCAATTACATATCTCAAAGGCAATGAAACTTCTTTGAATGATAGAAGTTCAAGGTCACATCAAATAATCAGATTGACTATTGAGAGTAGCCATCTAGAAGAATCAGGACGTGTGAAATCCCTCTGTGGTGGGAAAAACATTGGTCATGTACCATATAGAGATTCAAAACTGACAAGAATATTGCAGTCATCACTTGGAGG...

Protein

Download Protein FASTA

139 aa · TkA08G234890|TK1151|PROTEIN

MFKHLTCLELEDNKHVKPDFSITYLKGNETSLNDRSSRSHQIIRLTIESSHLEESGRVKSLCGGKNIGHVPYRDSKLTRILQSSLGGNARTAIICIMIPALSHVDQSRNTLAFANSAKEDTSIAQVNMVVGEKQMVKHL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G234890`
TK1151 ID	TkA08G234890
OH-1004 ID	LXL04_033146
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	97.100
Protein coverage (%)	TK1151 100.000 / OH-1004 43.396 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G234890

Location Chr08:61234987-61236723 (+)

Description Similar to Glutamate--tRNA ligase, chloroplastic/mitochondrial

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g18370`	Probable plus end-directed motor protein that functions in the NACK-PQR (ANP1-MKK6-MPK4) MAP kinase signaling pathway, which is essential for somatic cell cytokinesis, especially for the cell-plate formation and its expansion.	Expansion of the cell plate in plant cytokinesis requires a kinesin-like protein/MAPKKK complex.2002 · DOI: 10.1016/s0092-8674(02)00691-8 The AtNACK1/HINKEL and STUD/TETRASPORE/AtNACK2 genes, which encode functionally redundant kinesins, are essential for cytokinesis in Arabidopsis.2004 · DOI: 10.1111/j.1365-2443.2004.00798.x Arabidopsis kinesins HINKEL and TETRASPORE act redundantly to control cell plate expansion during cytokinesis in the male gametophyte.2008 · DOI: 10.1093/mp/ssn042 HINKEL kinesin, ANP MAPKKKs and MKK6/ANQ MAPKK, which phosphorylates and activates MPK4 MAPK, constitute a pathway that is required for cytokinesis in Arabidopsis thaliana.2010 · DOI: 10.1093/pcp/pcq135 Phosphorylation of a mitotic kinesin-like protein and a MAPKKK by cyclin-dependent kinases (CDKs) is involved in the transition to cytokinesis in plants.2011 · DOI: 10.1073/pnas.1110174108
`At3g43210`	Probable plus end-directed motor protein that functions in the NACK-PQR (ANP3-MKK6-MPK4) MAP kinase signaling pathway, which is essential for somatic cell cytokinesis, especially for the cell-plate formation and its expansion.	The AtNACK1/HINKEL and STUD/TETRASPORE/AtNACK2 genes, which encode functionally redundant kinesins, are essential for cytokinesis in Arabidopsis.2004 · DOI: 10.1111/j.1365-2443.2004.00798.x Arabidopsis kinesins HINKEL and TETRASPORE act redundantly to control cell plate expansion during cytokinesis in the male gametophyte.2008 · DOI: 10.1093/mp/ssn042 HINKEL kinesin, ANP MAPKKKs and MKK6/ANQ MAPKK, which phosphorylates and activates MPK4 MAPK, constitute a pathway that is required for cytokinesis in Arabidopsis thaliana.2010 · DOI: 10.1093/pcp/pcq135 AtMPK4 is required for male-specific meiotic cytokinesis in Arabidopsis.2011 · DOI: 10.1111/j.1365-313x.2011.04642.x

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0513900`	May be essential to promote the progression of cytokinesis during node-internode differentiation.	The rice mutant dwarf bamboo shoot 1: a leaky mutant of the NACK-type kinesin-like gene can initiate organ primordia but not organ development.2005 · DOI: 10.1093/pcp/pci206

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_033146 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006424 glutamyl-tRNA aminoacylation Biological Process

GO:0007005 mitochondrion organization Biological Process

GO:0009658 chloroplast organization Biological Process

GO:0009791 post-embryonic development Biological Process

GO:0048481 plant ovule development Biological Process

GO:0048608 reproductive structure development Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009536 plastid Cellular Component

GO:0009570 chloroplast stroma Cellular Component

KEGG gene cross-reference

ath:AT5G64050

fno:Fnod_0678

fno:Fnod_0777

nta:107784556

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.625

Rank 1 · TkA08G234890 · TK1151

Nucleus0.317

Rank 2 · TkA08G234890 · TK1151

Mitochondrion0.067

Rank 3 · TkA08G234890 · TK1151

Cell membrane0.060

Rank 4 · TkA08G234890 · TK1151

Golgi apparatus0.030

Rank 5 · TkA08G234890 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00225Kinesin28-57 aa

PF00225Kinesin66-119 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G234890	`PF00225`	Kinesin	28	57	1.5e-23	84.0
TkA08G234890	`PF00225`	Kinesin	66	119	1.5e-23	84.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8S905`	Arabidopsis thaliana	sp\|Q8S905\|KN7A_ARATH Kinesin-like protein KIN-7A	52.600%	Swiss-Prot	High
`Q8LNZ2`	Arabidopsis thaliana	sp\|Q8LNZ2\|KN7B_ARATH Kinesin-like protein KIN-7B	46.300%	Swiss-Prot	Medium
`Q9AWM8`	Oryza sativa subsp. japonica	sp\|Q9AWM8\|KN7A_ORYSJ Kinesin-like protein KIN-7A	48.300%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card