TkA08G231800 | RubberDandelionOmics

Gene overview

TkA08G231800

Reference: TK1151 Chr: Chr08 Coordinates: 60367184-60369222 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

874 bp · TkA08G231800|TK1151|cDNA

TTAAGAACGGATTATGAAATTGACGGAACAGAGAAACAGGCGAGAATCGAATGGAGGATGCAGAGGACGGCTTGTCGGATATGTCGTCGTCTTCTCCTCTTCACCTTGAATTCGTGCTGGAATACGAAACCTGGAGAACCCACCTAAACCGGATGCGAAATCGGACATGGAAGATGGGTGATGGAAAGCTAGGGTTGGGTGTTCCTAGAATTCGTGCTGGAATACAAAACCTGGATAATCCACCTAAACCGGATGCGAAA...

CDS

Download CDS FASTA

435 bp · TkA08G231800|TK1151|CDS

ATGTCCCCAATTGTCCATATTGTGAACATTGGATCCACCATGACCGAATCTGTTGCAAATGTCACTGAAATACATGAGGGGCTGGATTTTTCTGGTCATGATGGAGAAGAGGAAGATGATTACTCATTCGGGATTTTTTCTGTAAAATTTTCAACAGATGGACGAGAGCTTGTAGTTGCAACTAGTGATGATTCAATTTATGTTTATGATCTTGTAGCCAACAAGTTAAATGTTCGCATACCAGCTTACAAAGCTGCTAG...

Protein

Download Protein FASTA

144 aa · TkA08G231800|TK1151|PROTEIN

MSPIVHIVNIGSTMTESVANVTEIHEGLDFSGHDGEEEDDYSFGIFSVKFSTDGRELVVATSDDSIYVYDLVANKLNVRIPAYKAARYNDIDDVKSLAAIGAEVSSLNSHVRTPVDEAAIGGKMDVIDAINTLVAQMELTRTSV

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G231800`
TK1151 ID	TkA08G231800
OH-1004 ID	LXL04_033113
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	88.900
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA08G231800`
Location	Chr08:60367184-60369222 (-)
Description	Similar to LEC14B homolog
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_033113` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0016567 protein ubiquitination Biological Process GO:0043161 proteasome-mediated ubiquitin-dependent protein catabolic process Biological Process GO:0080135 regulation of cellular response to stress Biological Process GO:1902412 regulation of mitotic cytokinesis Biological Process GO:0005654 nucleoplasm Cellular Component GO:0080008 Cul4-RING E3 ubiquitin ligase complex Cellular Component
KEGG gene cross-reference	bta:539433 hsa:80344 pon:100173316 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.650

Rank 1 · TkA08G231800 · TK1151

Cytoplasm0.433

Rank 2 · TkA08G231800 · TK1151

Cell membrane0.036

Rank 3 · TkA08G231800 · TK1151

Mitochondrion0.030

Rank 4 · TkA08G231800 · TK1151

Extracellular0.028

Rank 5 · TkA08G231800 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF25171Beta-prop_WDR36-Utp21_1st2-82 aa

PF09100Qn_am_d_aIV3-74 aa

PF23098Beta-prop_NOL10_N22-75 aa

PF00400WD4043-70 aa

PF24807WD40_CDC20-Fz44-107 aa

PF23414Beta-prop_EML_244-73 aa

PF25175Beta-prop_WDR544-77 aa

PF12894ANAPC4_WD4044-83 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G231800	`PF25171`	Beta-prop_WDR36-Utp21_1st	2	82	0.1	12.8
TkA08G231800	`PF09100`	Qn_am_d_aIV	3	74	0.058	13.9
TkA08G231800	`PF23098`	Beta-prop_NOL10_N	22	75	0.057	13.3
TkA08G231800	`PF00400`	WD40	43	70	0.0028	18.9
TkA08G231800	`PF24807`	WD40_CDC20-Fz	44	107	0.0017	18.4
TkA08G231800	`PF23414`	Beta-prop_EML_2	44	73	0.0018	18.4
TkA08G231800	`PF25175`	Beta-prop_WDR5	44	77	0.032	14.3
TkA08G231800	`PF12894`	ANAPC4_WD40	44	83	0.08	13.9
TkA08G231800	`PF25173`	Beta-prop_WDR3_1st	45	82	0.0071	16.8
TkA08G231800	`PF23381`	Beta-prop_IFT122_1st	45	76	0.019	15.0
TkA08G231800	`PF25168`	Beta-prop_WDR36-Utp21_2nd	45	76	0.044	13.8
TkA08G231800	`PF24817`	WD40_WDHD1_1st	45	79	0.1	12.5
TkA08G231800	`PF24814`	WD40_Prp19	45	83	0.11	12.3
TkA08G231800	`PF25174`	Beta-prop_THOC3	46	74	0.022	14.5
TkA08G231800	`PF24796`	WDR55	47	84	0.0019	18.0
TkA08G231800	`PF12894`	ANAPC4_WD40	123	142	0.08	13.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card