Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1399 bp · TkA08G228890|TK1151|cDNA
ATGTTCATTCAGGGACAATCGGCTGCAAGTGTGGCAGAAATGGGCTGCTGTGGTTGTTTTGGATTTTCATTTGCAAAAAAGCACAAGAACTTGAGGCCAACTGTACAGGGGGGAAACCATGTTTTACAACAAGGGCTCTTAAATGAAGAGTTTGAAGAAGAAGAAAATGAGGAAGAAGAAGAAGAAGAAGATAACAACTCATATAGTGAAACAGATACAGAAAAAGGAGATGATGAAGAGTTGAGAACCACCCCTGCTAA...
1248 bp · TkA08G228890|TK1151|CDS
ATGTTCATTCAGGGACAATCGGCTGCAAGTGTGGCAGAAATGGGCTGCTGTGGTTGTTTTGGATTTTCATTTGCAAAAAAGCACAAGAACTTGAGGCCAACTGTACAGGGGGGAAACCATGTTTTACAACAAGGGCTCTTAAATGAAGAGTTTGAAGAAGAAGAAAATGAGGAAGAAGAAGAAGAAGAAGATAACAACTCATATAGTGAAACAGATACAGAAAAAGGAGATGATGAAGAGTTGAGAACCACCCCTGCTAA...
Protein
Download Protein FASTA415 aa · TkA08G228890|TK1151|PROTEIN
MFIQGQSAASVAEMGCCGCFGFSFAKKHKNLRPTVQGGNHVLQQGLLNEEFEEEENEEEEEEEDNNSYSETDTEKGDDEELRTTPAKTSQEILIYRTENDLICREFPVKQTHKVVRSEDENGNKMVNEYVRECKIGAGSYGKVVLYRSQVDGKHYAIKAFHKSHLLKLRVAPSETAMTDVFREVLIMKMLSHPNIVNLFEVIDDPNMDHFYMVLEYVEGKWVFEGAGVPGGLGENVARRYLRDIVSGLMYLHAHNVVHGD...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA08G228890 |
|---|---|
| TK1151 ID | TkA08G228890 |
| OH-1004 ID | LXL04_033074 |
| Relationship / confidence | Rbh High Identity Coverage Synteny / Strict |
| Protein identity (%) | 99.500 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 100.000Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA08G228890 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr08:59604130-59607563 (-) | |||||||||
| Description | Similar to GRIK2: Serine/threonine-protein kinase GRIK2 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0006468 protein phosphorylation Biological Process GO:0009615 response to virus Biological Process GO:0032147 activation of protein kinase activity Biological Process GO:0035556 intracellular signal transduction Biological Process GO:0045860 positive regulation of protein kinase activity Biological Process GO:0046777 protein autophosphorylation Biological Process GO:0061762 CAMKK-AMPK signaling cascade Biological Process GO:1903599 positive regulation of autophagy of mitochondrion Biological Process GO:0005634 nucleus Cellular Component GO:0005654 nucleoplasm Cellular Component GO:0005737 cytoplasm Cellular Component GO:0005829 cytosol Cellular Component | |||||||||
| KEGG gene cross-reference | ath:AT3G45240 ath:AT5G60550 ddi:DDB_G0279405 mmu:55984 rno:83506 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF04931DNA_pol_phi49-80 aaPF03109ABC1103-162 aaPF00069Pkinase129-390 aaPF07714PK_Tyr_Ser-Thr133-386 aaPF13095FTA2144-169 aaPF01636APH168-254 aaPF01163RIO1179-217 aaPF06176WaaY208-284 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA08G228890 | PF04931 | DNA_pol_phi | 49 | 80 | 7.4 | 5.3 |
| TkA08G228890 | PF03109 | ABC1 | 103 | 162 | 0.0088 | 15.9 |
| TkA08G228890 | PF00069 | Pkinase | 129 | 390 | 4e-58 | 197.6 |
| TkA08G228890 | PF07714 | PK_Tyr_Ser-Thr | 133 | 386 | 3e-29 | 102.9 |
| TkA08G228890 | PF13095 | FTA2 | 144 | 169 | 0.06 | 13.7 |
| TkA08G228890 | PF01636 | APH | 168 | 254 | 0.0009 | 19.8 |
| TkA08G228890 | PF01163 | RIO1 | 179 | 217 | 0.16 | 12.3 |
| TkA08G228890 | PF06176 | WaaY | 208 | 284 | 0.06 | 13.7 |
| TkA08G228890 | PF03109 | ABC1 | 211 | 288 | 0.0088 | 15.9 |
| TkA08G228890 | PF13095 | FTA2 | 234 | 267 | 0.06 | 13.7 |
| TkA08G228890 | PF14531 | Kinase-like | 236 | 367 | 7.1e-07 | 29.5 |
| TkA08G228890 | PF01163 | RIO1 | 236 | 281 | 0.16 | 12.3 |
| TkA08G228890 | PF17667 | Pkinase_fungal | 241 | 313 | 0.089 | 12.2 |
| TkA08G228890 | PF07387 | Seadorna_VP7 | 246 | 278 | 0.048 | 13.4 |
| TkA08G228890 | PF01636 | APH | 256 | 271 | 0.0009 | 19.8 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.