Gene Card
Gene overview
cDNA / CDS / Protein Sequences
889 bp · TkA08G207750|TK1151|cDNA
CGGCCATGTTTTTACCTCTCCCACTCTCATCAAAACCCCCCCTCTACCCTAAACTCCCATCACCACATCCCATCAATTTCTCTCTGCAAAACTTCTCCGATTCCGATAATGCCACCGACGCCGGAACAACCCCACCTCAACGGAGCCTATTATGGCCCTCCCATCCAACCAAAAACCAAATCTTACTACAGCCGTGGCCGCGGCGGAGGCGGAGGCGGAGGCGGCATGTGTTGCAACCCTTTAACCTGTTGTTGCAGCTG...
813 bp · TkA08G207750|TK1151|CDS
CGGCCATGTTTTTACCTCTCCCACTCTCATCAAAACCCCCCCTCTACCCTAAACTCCCATCACCACATCCCATCAATTTCTCTCTGCAAAACTTCTCCGATTCCGATAATGCCACCGACGCCGGAACAACCCCACCTCAACGGAGCCTATTATGGCCCTCCCATCCAACCAAAAACCAAATCTTACTACAGCCGTGGCCGCGGCGGAGGCGGAGGCGGAGGCGGCATGTGTTGCAACCCTTTAACCTGTTGTTGCAGCTG...
Protein
Download Protein FASTA270 aa · TkA08G207750|TK1151|PROTEIN
RPCFYLSHSHQNPPSTLNSHHHIPSISLCKTSPIPIMPPTPEQPHLNGAYYGPPIQPKTKSYYSRGRGGGGGGGGMCCNPLTCCCSCICSCILNLICQILITVGIFLAVVGLICWFIFRPNVPKFHVDDAALTQFTLSPTNDTLYYNLAVNMTFRNPNRRLAIYYDKIEASALYHGQRFATADVQGFYLGHKKENNVTAVFKGEQLVVLGGGDKSKYDSEKNDDVYNIDLKLRLKIRFKVWWAKTPKFKPNFECDLKVPL...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA08G207750 |
|---|---|
| TK1151 ID | TkA08G207750 |
| OH-1004 ID | LXL04_014421 |
| Relationship / confidence | Multi Source To Oh1004 / Complex relationship |
| Protein identity (%) | 59.200 |
| Protein coverage (%) | TK1151 81.481 / OH-1004 90.213Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA08G207750 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr08:54259645-54266375 (+) | |||||||||
| Description | Similar to NHL3: NDR1/HIN1-like protein 3 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0006886 intracellular protein transport Biological Process GO:0006891 intra-Golgi vesicle-mediated transport Biological Process GO:0006906 vesicle fusion Biological Process GO:0009611 response to wounding Biological Process GO:0009617 response to bacterium Biological Process GO:0009751 response to salicylic acid Biological Process GO:0010150 leaf senescence Biological Process GO:0042742 defense response to bacterium Biological Process GO:0048278 vesicle docking Biological Process GO:0051607 defense response to virus Biological Process GO:0051707 response to other organism Biological Process GO:0071456 cellular response to hypoxia Biological Process | |||||||||
| KEGG gene cross-reference | ath:AT1G32270 ath:AT2G35980 ath:AT3G11650 ath:AT5G06320 ath:AT5G53730 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF28887PilO_N94-125 aaPF03168LEA_2153-247 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA08G207750 | PF28887 | PilO_N | 94 | 125 | 0.22 | 12.2 |
| TkA08G207750 | PF03168 | LEA_2 | 153 | 247 | 6.4e-09 | 36.9 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.