LXL04_014421 | RubberDandelionOmics

Gene overview

LXL04_014421

Reference: OH-1004 Chr: Chr03 Coordinates: 48806358-48807065 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

708 bp · LXL04_014421|LXL04_014421|OH1004|cDNA

ATGTCTTCCGCCAATGAACCTCACCTCAACGGAGCTTACTACGGCCCATCAATCCCACCTCCGAACAAAAAGTCCCGATCCTACAACCGCCCTGGACGCGGCGGCGGAAGCTGCAACCCACTCTCATGCCTCTGCGGTTGTATCTTCAATCTCGTCTTCCAAATCATCATCACCATAGTCGTCCTCCTCGGTATCGCTGTCCTCGTCTTCTGGCTCATCTTCCGCCCTAACGCCCCAAAATTCCATGTCAACGAAGCTAC...

CDS

Download CDS FASTA

708 bp · LXL04_014421|LXL04_014421|OH1004|CDS

ATGTCTTCCGCCAATGAACCTCACCTCAACGGAGCTTACTACGGCCCATCAATCCCACCTCCGAACAAAAAGTCCCGATCCTACAACCGCCCTGGACGCGGCGGCGGAAGCTGCAACCCACTCTCATGCCTCTGCGGTTGTATCTTCAATCTCGTCTTCCAAATCATCATCACCATAGTCGTCCTCCTCGGTATCGCTGTCCTCGTCTTCTGGCTCATCTTCCGCCCTAACGCCCCAAAATTCCATGTCAACGAAGCTAC...

Protein

Download Protein FASTA

235 aa · LXL04_014421|LXL04_014421|OH1004|PROTEIN

MSSANEPHLNGAYYGPSIPPPNKKSRSYNRPGRGGGSCNPLSCLCGCIFNLVFQIIITIVVLLGIAVLVFWLIFRPNAPKFHVNEATLTQFTLSPDNNTLYYNLAVNMTFRNPNRRIGIYYDKIEANAEYYGKRFSTRDLDTFYLGHKRENNVGTVFVGEQVVVLENDDRSRYSTETNDRIYNIDLKLKLRLRLKVGWAKPKFKPKLECELKVPITSGGRVSSTGFQRTKCDFDW

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_014421`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_014421

Location Chr03:48806358-48807065 (-)

Description Similar to NHL3: NDR1/HIN1-like protein 3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g06320`	Confers resistance to Pseudomonas syringae pv. tomato DC3000 (Pst DC3000).	The Arabidopsis NHL3 gene encodes a plasma membrane protein and its overexpression correlates with increased resistance to Pseudomonas syringae pv. tomato DC3000.2003 · DOI: 10.1104/pp.103.020438
`At3g11650`	May play a role in plant immunity.	No verified direct reference in this release
`At2g35980`	May play a role in plant immunity.	No verified direct reference in this release
`At1g32270`	Vesicle trafficking protein that functions in the secretory pathway.	No verified direct reference in this release
`At5g53730`	Involved in the regulation of sugar, amino acid and some primary metabolite export from companion cells (CCs) to sieve elements (SEs) in phloem.	Increased expression of a phloem membrane protein encoded by NHL26 alters phloem export and sugar partitioning in Arabidopsis.2013 · DOI: 10.1105/tpc.113.111849

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_014421 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006886 intracellular protein transport Biological Process

GO:0006891 intra-Golgi vesicle-mediated transport Biological Process

GO:0006906 vesicle fusion Biological Process

GO:0009611 response to wounding Biological Process

GO:0009617 response to bacterium Biological Process

GO:0009751 response to salicylic acid Biological Process

GO:0010150 leaf senescence Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0048278 vesicle docking Biological Process

GO:0051607 defense response to virus Biological Process

GO:0051707 response to other organism Biological Process

GO:0071456 cellular response to hypoxia Biological Process

KEGG gene cross-reference

ath:AT1G32270

ath:AT2G35980

ath:AT3G11650

ath:AT5G06320

ath:AT5G53730

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.808

Rank 1 · LXL04_014421 · OH-1004

Cytoplasm0.107

Rank 2 · LXL04_014421 · OH-1004

Endoplasmic reticulum0.082

Rank 3 · LXL04_014421 · OH-1004

Extracellular0.079

Rank 4 · LXL04_014421 · OH-1004

Lysosome / Vacuole0.049

Rank 5 · LXL04_014421 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03168.20LEA_2109-199 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_014421	`PF03168.20`	LEA_2	109	199	4.5e-08	34.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FNH6`	Arabidopsis thaliana	NDR1/HIN1-like protein 3	53.913%	Swiss-Prot	strong database homology
`Q9SRN1`	Arabidopsis thaliana	NDR1/HIN1-like protein 2	44.583%	Swiss-Prot	moderate database homology
`Q9SJ52`	Arabidopsis thaliana	NDR1/HIN1-like protein 10	44.255%	Swiss-Prot	moderate database homology
`Q9C615`	Arabidopsis thaliana	Putative syntaxin-24	33.750%	Swiss-Prot	moderate database homology
`Q9FI03`	Arabidopsis thaliana	NDR1/HIN1-like protein 26	27.374%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card