RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA08G205220
Reference: TK1151 Chr: Chr08 Coordinates: 53620773-53624626 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

2960 bp · TkA08G205220|TK1151|cDNA

CGAAGATCTTATATATGGTAGGTTGACTATAAAGCATTATAAATATTATTAGACAGCCATTTCCAAATATAAACTATAATTCTTCAAAAAGACGTTCCCTGCTACTGGCCATTACATGGAATCTGAATCATACTCCTTGCAATGGCCACAACCTTGCCGCCACTTTAAATTTCCTGAAATTCGGTTAGCCACTAGAAACTTTGATGAATCCTTAGTAATAGGGCATGGGGGATTTGGAAAAGTTTACAAAGGTACCATTC...

CDS

Download CDS FASTA

2508 bp · TkA08G205220|TK1151|CDS

ATGGAATCTGAATCATACTCCTTGCAATGGCCACAACCTTGCCGCCACTTTAAATTTCCTGAAATTCGGTTAGCCACTAGAAACTTTGATGAATCCTTAGTAATAGGGCATGGGGGATTTGGAAAAGTTTACAAAGGTACCATTCACGATGGATCAAGTCTTGTTGTTGCTGCCATTAAACGACTGGATTCCAAGTCCGATCAAGGAGCTGATGAGTTTTGGGCCGAAGTCAAGATGCTTTCCAAGTTGCGCCACTGCCA...

Protein

Download Protein FASTA

835 aa · TkA08G205220|TK1151|PROTEIN

MESESYSLQWPQPCRHFKFPEIRLATRNFDESLVIGHGGFGKVYKGTIHDGSSLVVAAIKRLDSKSDQGADEFWAEVKMLSKLRHCHLVSLIGYCDDRNEMILVYEYMPYGSFEDHLHKFSTPLPWLQRLKLCIGAARGLDYLHTGTGIEFGVIHRDVKSANILLNDSWAAKIADFGLSKIGPKDQPFSHVSTLVKGTFGYLDPDYFYTGRLTRKSDVYAFGVVLFEVLCRKRALDASRDEEQHSLARWVQDSIKDGTLK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA08G205220
TK1151 IDTkA08G205220
OH-1004 IDLXL04_032797
Relationship / confidenceSequence Supported Annotation Or Model Conflict / Review
Protein identity (%)99.600
Protein coverage (%)TK1151 100.000 / OH-1004 50.000
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA08G205220
LocationChr08:53620773-53624626 (-)
DescriptionSimilar to MPK14: Mitogen-activated protein kinase 14
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At5g19010 Mitogen-activated protein kinase 16. No verified direct reference in this release
At3g18040 Mitogen-activated protein kinase 9. No verified direct reference in this release
At2g42880 Mitogen-activated protein kinase 20. No verified direct reference in this release
At1g18150 MKK3-MPK8 and CAMs-MPK8 modules negatively regulates ROS accumulation through controlling expression of the RBOHD gene during wounding.
Calmodulin-dependent activation of MAP kinase for ROS homeostasis in Arabidopsis.2011 · DOI: 10.1016/j.molcel.2011.02.029

Rice

Reference gene IDPossible functionPapers / DOI
Os11g0271100 Mitogen-activated protein kinase 15. No verified direct reference in this release
Os05g0143500 Mitogen-activated protein kinase 14. No verified direct reference in this release
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_032797 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0007165 signal transduction Biological Process
GO:0035556 intracellular signal transduction Biological Process
GO:0000325 plant-type vacuole Cellular Component
GO:0005634 nucleus Cellular Component
GO:0005737 cytoplasm Cellular Component
GO:0004674 protein serine/threonine kinase activity Molecular Function
GO:0004707 MAP kinase activity Molecular Function
GO:0005524 ATP binding Molecular Function
GO:0106310 protein serine kinase activity Molecular Function
KEGG gene cross-reference
ath:AT5G19010
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.504
Rank 1 · TkA08G205220 · TK1151
Cell membrane0.320
Rank 2 · TkA08G205220 · TK1151
Nucleus0.319
Rank 3 · TkA08G205220 · TK1151
Endoplasmic reticulum0.048
Rank 4 · TkA08G205220 · TK1151
Golgi apparatus0.048
Rank 5 · TkA08G205220 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069Pkinase34-301 aa
PF07714PK_Tyr_Ser-Thr34-303 aa
PF03109ABC135-56 aa
PF01636APH70-118 aa
PF17667Pkinase_fungal115-168 aa
PF03109ABC1149-180 aa
PF01636APH150-183 aa
PF01163RIO1150-176 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA08G205220PF00069Pkinase343012.6e-108362.1
TkA08G205220PF07714PK_Tyr_Ser-Thr343033.3e-80269.8
TkA08G205220PF03109ABC135565.3e-0626.5
TkA08G205220PF01636APH701180.00218.7
TkA08G205220PF17667Pkinase_fungal1151680.02713.9
TkA08G205220PF03109ABC11491805.3e-0626.5
TkA08G205220PF01636APH1501830.00218.7
TkA08G205220PF01163RIO11501760.2711.6
TkA08G205220PF14531Kinase-like1522410.0002521.1
TkA08G205220PF06293Kdo1521670.000321.0
TkA08G205220PF12330Haspin_kinase1541894.7e-0523.3
TkA08G205220PF05445Pox_ser-thr_kin1541690.02814.1
TkA08G205220PF00069Pkinase3956862.6e-108362.1
TkA08G205220PF07714PK_Tyr_Ser-Thr3966153.3e-80269.8
TkA08G205220PF06293Kdo4355340.000321.0
TkA08G205220PF01636APH4395150.00218.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q8W4J2Arabidopsis thalianasp|Q8W4J2|MPK16_ARATH Mitogen-activated protein kinase 1667.000%Swiss-ProtMedium
Q9LV37Arabidopsis thalianasp|Q9LV37|MPK9_ARATH Mitogen-activated protein kinase 968.400%Swiss-ProtLow
Q9SJG9Arabidopsis thalianasp|Q9SJG9|MPK20_ARATH Mitogen-activated protein kinase 2068.500%Swiss-ProtLow
Q9LM33Arabidopsis thalianasp|Q9LM33|MPK8_ARATH Mitogen-activated protein kinase 876.300%Swiss-ProtLow
Q53N72Oryza sativa subsp. japonicasp|Q53N72|MPK15_ORYSJ Mitogen-activated protein kinase 1573.000%Swiss-ProtLow
Q75KK8Oryza sativa subsp. japonicasp|Q75KK8|MPK14_ORYSJ Mitogen-activated protein kinase 1472.300%Swiss-ProtLow

JBrowse

View in Genome Browser