LXL04_032797 | RubberDandelionOmics

Gene overview

LXL04_032797

Reference: OH-1004 Chr: Chr07 Coordinates: 29405173-29415164 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

5013 bp · LXL04_032797|LXL04_032797|OH1004|cDNA

ATGGAATCTGAATCATACTCCTTGCAATGGCCACAACCTTGCCGCCACTTTAAATTTCCTGAAATTCGGTTAGCCACTAGAAACTTTGATGAATCCTTAGTAATAGGGCATGGGGGATTTGGAAAAGTTTACAAAGGTACCATTCACGATGGATCAAGTCTTGTTGTTGCTGCCATTAAACGACTGGATTCCAAGTCCGATCAAGGAGCTGATGAGTTTTGGGCCGAAGTCAAGATGCTTTCCAAGTTGCGCCACTGCCA...

CDS

Download CDS FASTA

5013 bp · LXL04_032797|LXL04_032797|OH1004|CDS

ATGGAATCTGAATCATACTCCTTGCAATGGCCACAACCTTGCCGCCACTTTAAATTTCCTGAAATTCGGTTAGCCACTAGAAACTTTGATGAATCCTTAGTAATAGGGCATGGGGGATTTGGAAAAGTTTACAAAGGTACCATTCACGATGGATCAAGTCTTGTTGTTGCTGCCATTAAACGACTGGATTCCAAGTCCGATCAAGGAGCTGATGAGTTTTGGGCCGAAGTCAAGATGCTTTCCAAGTTGCGCCACTGCCA...

Protein

Download Protein FASTA

1670 aa · LXL04_032797|LXL04_032797|OH1004|PROTEIN

MESESYSLQWPQPCRHFKFPEIRLATRNFDESLVIGHGGFGKVYKGTIHDGSSLVVAAIKRLDSKSDQGADEFWAEVKMLSKLRHCHLVSLIGYCDDRNEMILVYEYMPYGSFEDHLHKFSTPLPWLQRLKLCIGAARGLDYLHTGTGIEFGVIHRDVKSANILLNDSWAAKIADFGLSKIGPKDQPFSHVSTLVKGTFGYLDPDYFYTGRLTRKSDVYAFGVVLFEVLCRKRALDASRDEEQHSLARWVQDSIKDGTLK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_032797`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_032797

Location Chr07:29405173-29415164 (-)

Description Similar to MPK14: Mitogen-activated protein kinase 14

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g19010`	Mitogen-activated protein kinase 16.	No verified direct reference in this release
`At1g73670`	Mitogen-activated protein kinase 15.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os05g0143500`	Mitogen-activated protein kinase 14.	No verified direct reference in this release
`Os11g0271100`	Mitogen-activated protein kinase 15.	No verified direct reference in this release
`Os05g0576800`	Mitogen-activated protein kinase 17.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_032797 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0007165 signal transduction Biological Process

GO:0035556 intracellular signal transduction Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0004674 protein serine/threonine kinase activity Molecular Function

GO:0004707 MAP kinase activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0106310 protein serine kinase activity Molecular Function

KEGG gene cross-reference

ath:AT5G19010

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.644

Rank 1 · LXL04_032797 · OH-1004

Cytoplasm0.392

Rank 2 · LXL04_032797 · OH-1004

Cell membrane0.062

Rank 3 · LXL04_032797 · OH-1004

Endoplasmic reticulum0.040

Rank 4 · LXL04_032797 · OH-1004

Mitochondrion0.030

Rank 5 · LXL04_032797 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069.32Pkinase34-301 aa

PF07714.24PK_Tyr_Ser-Thr34-303 aa

PF00069.32Pkinase395-686 aa

PF07714.24PK_Tyr_Ser-Thr396-614 aa

PF27041.1ZBED1_RNase-like1102-1185 aa

PF27039.1ZBED1_RNase-like_helical1197-1293 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_032797	`PF00069.32`	Pkinase	34	301	2.5e-107	358.9
LXL04_032797	`PF07714.24`	PK_Tyr_Ser-Thr	34	303	3e-79	266.7
LXL04_032797	`PF00069.32`	Pkinase	395	686	2.5e-107	358.9
LXL04_032797	`PF07714.24`	PK_Tyr_Ser-Thr	396	614	3e-79	266.7
LXL04_032797	`PF27041.1`	ZBED1_RNase-like	1102	1185	3.1e-20	72.8
LXL04_032797	`PF27039.1`	ZBED1_RNase-like_helical	1197	1293	1e-19	71.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8W4J2`	Arabidopsis thaliana	Mitogen-activated protein kinase 16	61.101%	Swiss-Prot	weak database homology
`Q9C9U4`	Arabidopsis thaliana	Mitogen-activated protein kinase 15	61.822%	Swiss-Prot	weak database homology
`Q75KK8`	Oryza sativa subsp. japonica	Mitogen-activated protein kinase 14	72.554%	Swiss-Prot	weak database homology
`Q53N72`	Oryza sativa subsp. japonica	Mitogen-activated protein kinase 15	71.596%	Swiss-Prot	weak database homology
`Q6L5F7`	Oryza sativa subsp. japonica	Mitogen-activated protein kinase 17	68.983%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card