TkA08G205070 | RubberDandelionOmics

Gene overview

TkA08G205070

Reference: TK1151 Chr: Chr08 Coordinates: 53589021-53591981 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2004 bp · TkA08G205070|TK1151|cDNA

ATGGATATTTTTGCGGTAGCTTTGATGCATGAAGAGCATGGTGAAATGCAAGACATGATCGGGGTGGCGAATCTGGAGGCAATGTCTTTGCTTGGTTACTGTGATGATGGAAAAGAAATGATCATTGTCTACGAGTATATGCCTCATGGATCACTTGAAGCTCATCTCCATAAACTTTATACCCCTCTATCTTGGCTGCAAAGACTCAAAATATGCATAGGTGCCGCACGTGGGTTAGACTACCTCCACACTGGTAGAGG...

CDS

Download CDS FASTA

2004 bp · TkA08G205070|TK1151|CDS

ATGGATATTTTTGCGGTAGCTTTGATGCATGAAGAGCATGGTGAAATGCAAGACATGATCGGGGTGGCGAATCTGGAGGCAATGTCTTTGCTTGGTTACTGTGATGATGGAAAAGAAATGATCATTGTCTACGAGTATATGCCTCATGGATCACTTGAAGCTCATCTCCATAAACTTTATACCCCTCTATCTTGGCTGCAAAGACTCAAAATATGCATAGGTGCCGCACGTGGGTTAGACTACCTCCACACTGGTAGAGG...

Protein

Download Protein FASTA

667 aa · TkA08G205070|TK1151|PROTEIN

MDIFAVALMHEEHGEMQDMIGVANLEAMSLLGYCDDGKEMIIVYEYMPHGSLEAHLHKLYTPLSWLQRLKICIGAARGLDYLHTGRGIEFGVIHRDVKTANILLDESWVAKISDLGLSKKGPNVGHVSTLVKGTFGYLDPDYFYTGRLTTKSDVYAFGVVLFEVLCRKHASDVSRDGEHHGLARWAQDSIKKGSLKHLIDSEIRDQIFPKCLKIFAHTAKSCLHTNPKKRPTMAELVFSLESVFALQEKNNNSLQSKPIL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G205070`
TK1151 ID	TkA08G205070
OH-1004 ID	LXL04_032797
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	73.200
Protein coverage (%)	TK1151 38.981 / OH-1004 15.868 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G205070

Location Chr08:53589021-53591981 (+)

Description Similar to MPK14: Mitogen-activated protein kinase 14

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g28680`	Receptor-like protein kinase that controls pollen tube behavior by directing rupture at proper timing to release the sperm cell.	No verified direct reference in this release
`At3g04690`	Receptor-like protein kinase that controls pollen tube behavior by directing rupture at proper timing to release the sperm cell.	No verified direct reference in this release
`At3g51550`	May regulate MLO7 polarization in female gametophyte synergid cells to control pollen tube growth and male gamete delivery during fertilization.	FERONIA receptor-like kinase regulates RHO GTPase signaling of root hair development.2010 · DOI: 10.1073/pnas.1005366107
`At5g59700`	Probable receptor-like protein kinase At5g59700.	No verified direct reference in this release
`At3g46290`	Receptor-like protein kinase required for cell elongation during vegetative growth, mostly in a brassinosteroid-(BR-) independent manner.	Three related receptor-like kinases are required for optimal cell elongation in Arabidopsis thaliana.2009 · DOI: 10.1073/pnas.0812346106

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_032797 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0007165 signal transduction Biological Process

GO:0035556 intracellular signal transduction Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0004674 protein serine/threonine kinase activity Molecular Function

GO:0004707 MAP kinase activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0106310 protein serine kinase activity Molecular Function

KEGG gene cross-reference

ath:AT5G19010

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.324

Rank 1 · TkA08G205070 · TK1151

Cell membrane0.254

Rank 2 · TkA08G205070 · TK1151

Nucleus0.223

Rank 3 · TkA08G205070 · TK1151

Endoplasmic reticulum0.168

Rank 4 · TkA08G205070 · TK1151

Mitochondrion0.124

Rank 5 · TkA08G205070 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07714PK_Tyr_Ser-Thr15-238 aa

PF00069Pkinase29-237 aa

PF22486MATH_2300-407 aa

PF00917MATH304-407 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G205070	`PF07714`	PK_Tyr_Ser-Thr	15	238	8.2e-35	121.1
TkA08G205070	`PF00069`	Pkinase	29	237	5.6e-29	102.0
TkA08G205070	`PF22486`	MATH_2	300	407	3.5e-20	73.3
TkA08G205070	`PF00917`	MATH	304	407	2.4e-09	38.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q3E8W4`	Arabidopsis thaliana	sp\|Q3E8W4\|ANX2_ARATH Receptor-like protein kinase ANXUR2	50.000%	Swiss-Prot	Low
`Q9SR05`	Arabidopsis thaliana	sp\|Q9SR05\|ANX1_ARATH Receptor-like protein kinase ANXUR1	49.000%	Swiss-Prot	Low
`Q9SCZ4`	Arabidopsis thaliana	sp\|Q9SCZ4\|FERON_ARATH Receptor-like protein kinase FERONIA	49.800%	Swiss-Prot	Low
`Q9FN92`	Arabidopsis thaliana	sp\|Q9FN92\|Y5597_ARATH Probable receptor-like protein kinase At5g59700	49.800%	Swiss-Prot	Low
`Q9LX66`	Arabidopsis thaliana	sp\|Q9LX66\|HERK_ARATH Receptor-like protein kinase HERK 1	53.600%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card