TkA08G202170 | RubberDandelionOmics

Gene overview

TkA08G202170

Reference: TK1151 Chr: Chr08 Coordinates: 52863387-52869375 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3759 bp · TkA08G202170|TK1151|cDNA

CAGCAGATAAGTGCATACCATAGGGACCAGAACTGTAATTTACTCTAGATCTCCAATGTTTTATTTTGACCCGGTAAAATAAAACGGGTCGAAAAACATACATCGGACCGACCGAAGTATATGAAAGGCGCCTCCTTTTTAACATTTGAATTTTCTACAATGTTGAGTGGCCCCACTTCCTCCCAATTCGTCAAATACTATATAATACGCACTCTTTGTAGCCGTTAGCAGACTTAAAATCCCTACTCTCGTCTCCTTCG...

CDS

Download CDS FASTA

3186 bp · TkA08G202170|TK1151|CDS

ATGGAGTATAAAAGAAGTACGACATCAATGACGCCGGATCATAATGGGAAAGCAGGAGTTGGAATGGTGGCCAATCCGTTGCCGTTTCTTACTCCTAGACCTGAACGGAGGCGTCCGGAATCTAGAGGCATTGATTGGAATTCTAGTAGAGTTGAGAAAGATCGTGGTGAAGTTAATATCCAAGTTCTGCTCAGATGCAGGCCTTTAAGCGATGAAGAACAAAAGTGCAATGTACCAAAGGCGATAACTTGCAACGAACA...

Protein

Download Protein FASTA

1061 aa · TkA08G202170|TK1151|PROTEIN

MEYKRSTTSMTPDHNGKAGVGMVANPLPFLTPRPERRRPESRGIDWNSSRVEKDRGEVNIQVLLRCRPLSDEEQKCNVPKAITCNEHKREVTISQNVANKQIDKLFTFDKVFGPKAQQRSIYDQAIFPIVNEVLEGFNCTVFAYGQTGTGKTYTMEGGMRNKGGDLPAEAGVIPRAVRQIFETLESQNADYSMKVTFLELYNEEIVDLLAPEDNSRSLDEKQKKPISLMEDGKGCVLVRGLEEEAVYSANDIYTLLERGA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G202170`
TK1151 ID	TkA08G202170
OH-1004 ID	LXL04_017721
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	47.300
Protein coverage (%)	TK1151 91.989 / OH-1004 93.702 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G202170

Location Chr08:52863387-52869375 (+)

Description Similar to KIN5D: Kinesin-like protein KIN-5D

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g37420`	Responsible for microtubule translocation.	No verified direct reference in this release
`At2g28620`	Responsible for microtubule translocation.	No verified direct reference in this release
`At3g45850`	Responsible for microtubule translocation.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os05g0117798`	Responsible for microtubule translocation.	No verified direct reference in this release
`Os03g0279832`	Responsible for microtubule translocation.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_017721 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000281 mitotic cytokinesis Biological Process

GO:0000911 cytokinesis by cell plate formation Biological Process

GO:0007018 microtubule-based movement Biological Process

GO:0007052 mitotic spindle organization Biological Process

GO:0009826 unidimensional cell growth Biological Process

GO:0043622 cortical microtubule organization Biological Process

GO:0051231 spindle elongation Biological Process

GO:0090307 mitotic spindle assembly Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005819 spindle Cellular Component

GO:0005874 microtubule Cellular Component

GO:0005876 spindle microtubule Cellular Component

KEGG gene cross-reference

ath:AT2G28620

ath:AT2G37420

dosa:Os05g0117798

osa:9268593

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.725

Rank 1 · TkA08G202170 · TK1151

Nucleus0.256

Rank 2 · TkA08G202170 · TK1151

Cell membrane0.080

Rank 3 · TkA08G202170 · TK1151

Golgi apparatus0.056

Rank 4 · TkA08G202170 · TK1151

Mitochondrion0.055

Rank 5 · TkA08G202170 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF16796Microtub_bd59-209 aa

PF00225Kinesin65-401 aa

PF24627PUMA_CC461-515 aa

PF09769ApoO486-533 aa

PF09769ApoO575-625 aa

PF26039Dcst2586-654 aa

PF24627PUMA_CC602-615 aa

PF09769ApoO607-657 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G202170	`PF16796`	Microtub_bd	59	209	8.9e-27	94.6
TkA08G202170	`PF00225`	Kinesin	65	401	6.3e-118	394.2
TkA08G202170	`PF24627`	PUMA_CC	461	515	0.01	16.6
TkA08G202170	`PF09769`	ApoO	486	533	6.8	7.3
TkA08G202170	`PF09769`	ApoO	575	625	6.8	7.3
TkA08G202170	`PF26039`	Dcst2	586	654	1.3	8.9
TkA08G202170	`PF24627`	PUMA_CC	602	615	0.01	16.6
TkA08G202170	`PF09769`	ApoO	607	657	6.8	7.3
TkA08G202170	`PF26039`	Dcst2	695	766	1.3	8.9
TkA08G202170	`PF16796`	Microtub_bd	729	791	8.9e-27	94.6
TkA08G202170	`PF16796`	Microtub_bd	825	866	8.9e-27	94.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q0WQJ7`	Arabidopsis thaliana	sp\|Q0WQJ7\|KN5B_ARATH Kinesin-like protein KIN-5B	58.800%	Swiss-Prot	High
`F4IIS5`	Arabidopsis thaliana	sp\|F4IIS5\|KN5A_ARATH Kinesin-like protein KIN-5A	45.400%	Swiss-Prot	Medium
`Q9LZU5`	Arabidopsis thaliana	sp\|Q9LZU5\|KN5D_ARATH Kinesin-like protein KIN-5D	47.000%	Swiss-Prot	Medium
`Q5W7C6`	Oryza sativa subsp. japonica	sp\|Q5W7C6\|KN5A_ORYSJ Kinesin-like protein KIN-5A	46.700%	Swiss-Prot	Medium
`B9F7C8`	Oryza sativa subsp. japonica	sp\|B9F7C8\|KN5B_ORYSJ Kinesin-like protein KIN-5B	46.000%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card