Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1371 bp · TkA08G200740|TK1151|cDNA
CAATAGGTACGGACTTCCAACATACAAACGTGCCACATATCCATCCAAGGTCAACGTAGGACGCCTACAGAAAATGGCTCCAATTCTCCCCTACGCTCACTGCGAGACCAAATTACGAGCTCTCGCCGGCCAAGCTGAGGGATTCGGCCGCCTTGCCACCGGTGGACTTCATGGACCACTCTACTGTGTCACTACTCTTGCCGATGATGGTCCTGGTTCACTACGTGATGCATGTCGCAAGAAAGAACCTTTATGGATTG...
981 bp · TkA08G200740|TK1151|CDS
ATGGCTCCAATTCTCCCCTACGCTCACTGCGAGACCAAATTACGAGCTCTCGCCGGCCAAGCTGAGGGATTCGGCCGCCTTGCCACCGGTGGACTTCATGGACCACTCTACTGTGTCACTACTCTTGCCGATGATGGTCCTGGTTCACTACGTGATGCATGTCGCAAGAAAGAACCTTTATGGATTGTTTTTGAAATATCGGGTGAAATTAAACTGAAATCTATTCTACCCGTGTCTTCATATAAAACAATTGATGGTCG...
Protein
Download Protein FASTA326 aa · TkA08G200740|TK1151|PROTEIN
MAPILPYAHCETKLRALAGQAEGFGRLATGGLHGPLYCVTTLADDGPGSLRDACRKKEPLWIVFEISGEIKLKSILPVSSYKTIDGRGQWIRITGMGLRLDQCEHVIICNLEFQEGRGHDVDAIQIKPNSKHIWIDRCSLKDYSDGLVDVTRGSTDVTISRCKFGYHDKTILIGANAGHCDDRNIRVTIHHCLFDGSRQRLPRVRFAKVHLYNNYTRYWAIYAVGASVESQIYSQCNIYEAGRDCNVAFKYIPEKAGDKN...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA08G200740 |
|---|---|
| TK1151 ID | TkA08G200740 |
| OH-1004 ID | LXL04_032725 |
| Relationship / confidence | Rbh High Identity Coverage Synteny / Strict |
| Protein identity (%) | 100.000 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 100.000Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA08G200740 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr08:52432640-52435515 (+) | |||||||||
| Description | Similar to At1g30350: Probable pectate lyase 4 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0009664 plant-type cell wall organization Biological Process GO:0042547 cell wall modification involved in multidimensional cell growth Biological Process GO:0045490 pectin catabolic process Biological Process GO:0098542 defense response to other organism Biological Process GO:0005576 extracellular region Cellular Component GO:0005886 plasma membrane Cellular Component GO:0016020 membrane Cellular Component GO:0098552 side of membrane Cellular Component GO:0030570 pectate lyase activity Molecular Function GO:0046872 metal ion binding Molecular Function | |||||||||
| KEGG gene cross-reference | ath:AT1G11920 ath:AT1G30350 ath:AT3G54920 ath:AT5G55720 sly:101253756 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF00544Pectate_lyase_473-258 aaPF13229Beta_helix96-194 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA08G200740 | PF00544 | Pectate_lyase_4 | 73 | 258 | 3.9e-27 | 95.9 |
| TkA08G200740 | PF13229 | Beta_helix | 96 | 194 | 0.019 | 15.3 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.