TkA08G198300 | RubberDandelionOmics

Gene overview

TkA08G198300

Reference: TK1151 Chr: Chr08 Coordinates: 51722599-51727481 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1849 bp · TkA08G198300|TK1151|cDNA

TCAAGATTTCGCACTAGTAACATTTGACATTAGGTATACGGTAACCCGCAACTGCTGATTGAAACAACAACCCCCACATTGGATCCTGTTGTGCTTGATATTCAACATCACTACAGAGAGTTTTGCTTGGAGAACAAGTTGAAAACCTGAACTTGCTCCGTTTTTGTAGTCAAAACAATGGCCGATGCGCAGCGACAGCCCAAAAAGAGACCCCATCAAGAATCTCTTGGCGATGCACTGCTGCACAAAAGAGAAAACAA...

CDS

Download CDS FASTA

381 bp · TkA08G198300|TK1151|CDS

ATGATGAGAGAGAAGAAACAATCAATTCTAGAGTCCCAAACTACTTCAGCTGTCCAAGAATTAAACTTGCAATCACCTTCCAGGAAAGGTGCAGTCCAGAAAAAGGTCAATGCTCTTCGCGAACTAAGACGCTTATTATCAAAATCCGAATTTCCTCCAATTGAAAACGCCATTAAATCTGGAGCTATACTTTACTTGCACAATGTCTTCTCATTTGGGTCCCAAGATGAGCAGTTGCTTGAAGCAGCTTGGTGTCTTAC...

Protein

Download Protein FASTA

126 aa · TkA08G198300|TK1151|PROTEIN

MMREKKQSILESQTTSAVQELNLQSPSRKGAVQKKVNALRELRRLLSKSEFPPIENAIKSGAILYLHNVFSFGSQDEQLLEAAWCLTNIAAGKLKKTRAYCLHLPLLIAHIGEKSSVQLQNSVHGQ

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G198300`
TK1151 ID	TkA08G198300
OH-1004 ID	LXL04_032694
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	79.700
Protein coverage (%)	TK1151 92.857 / OH-1004 22.736 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G198300

Location Chr08:51722599-51727481 (-)

Description Similar to IMPA9: Importin subunit alpha-9

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g03070`	Binds to conventional NLS motifs and mediates nuclear protein import across the nuclear envelope (By similarity).	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0158000`	Binds specifically and directly to substrates containing either a simple or bipartite NLS motif.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_032694 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006606 protein import into nucleus Biological Process

GO:0006607 NLS-bearing protein import into nucleus Biological Process

GO:0006612 protein targeting to membrane Biological Process

GO:0031144 proteasome localization Biological Process

GO:0051170 import into nucleus Biological Process

GO:0005634 nucleus Cellular Component

GO:0005635 nuclear envelope Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0010494 cytoplasmic stress granule Cellular Component

GO:0032991 protein-containing complex Cellular Component

GO:0042564 NLS-dependent protein nuclear import complex Cellular Component

KEGG gene cross-reference

ath:AT1G02690

ath:AT5G03070

dosa:Os01g0158000

sce:YNL189W

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.614

Rank 1 · TkA08G198300 · TK1151

Cytoplasm0.446

Rank 2 · TkA08G198300 · TK1151

Mitochondrion0.059

Rank 3 · TkA08G198300 · TK1151

Cell membrane0.034

Rank 4 · TkA08G198300 · TK1151

Endoplasmic reticulum0.029

Rank 5 · TkA08G198300 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00514Arm35-52 aa

PF00514Arm77-91 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G198300	`PF00514`	Arm	35	52	0.0092	16.7
TkA08G198300	`PF00514`	Arm	77	91	0.0092	16.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4KF65`	Arabidopsis thaliana	sp\|F4KF65\|IMPA9_ARATH Importin subunit alpha-9	62.400%	Swiss-Prot	High
`Q9FYP9`	Oryza sativa subsp. japonica	sp\|Q9FYP9\|IMAP2_ORYSJ Importin subunit alpha-2	52.000%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card