TkA08G185820 | RubberDandelionOmics

Gene overview

TkA08G185820

Reference: TK1151 Chr: Chr08 Coordinates: 48569831-48572120 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1557 bp · TkA08G185820|TK1151|cDNA

AGAGTCAAATCATTCAGACTGCAAGGCGGTCTGGTTTTCAATTTCAAACTCTCGTTAATACAAATCAACAAGTAATCGAGTCAATTTAGTTCATTAAAGCTTTTCGCATATGTACAGGGCTACGCTGCCAGAGAGTTCGAAAAGCAAGGAGTCAAACCTAACCAGCTAGCAATCATCTCTAAAGAGGCTGTAGCTCCTTACGAACGCCCTGCACTAAGCAAGGGATATCTGTTCCCTGAAGGATCTGCCAGACTTCCAGG...

CDS

Download CDS FASTA

738 bp · TkA08G185820|TK1151|CDS

ATGTTAGCATGGTGCATGCCTCGTTTATTCACTGCTGACATGGCGGCTTTCTACGAGGGGTATTATATAAAAAAAGGAGTGAAGATCATCAAAGGAACAGTTGCTGCGGGGTTTACAAGTAACGAAAAAGGAGAAGTAAAAGAAGCGAAACTAAAAGACGATCGGGTGATGGAAGCAGATATTGTCGTTGTTGGCGTCGGAGCAAAGCCTCTAATAAATCTATTCACAGGACAACTTGAAGAGGACAAAGGTGGAATCAA...

Protein

Download Protein FASTA

245 aa · TkA08G185820|TK1151|PROTEIN

MLAWCMPRLFTADMAAFYEGYYIKKGVKIIKGTVAAGFTSNEKGEVKEAKLKDDRVMEADIVVVGVGAKPLINLFTGQLEEDKGGIKTDAFFKTSVDNVYAIGDVATFPMKMYGDIRRVEHVDHSRKSAEQAVKAIFAKEQGKTIEAYDYLPYFYSRSFDLSWQFFGDNVGETVIYGNRDPASEKPKFGAYWIKGGKVVGAFLEGGTAEENKAISKVAKVQPPAPSPESLASEGIAFAIPNKLIS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G185820`
TK1151 ID	TkA08G185820
OH-1004 ID	LXL04_003711
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	80.900
Protein coverage (%)	TK1151 95.918 / OH-1004 54.147 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G185820

Location Chr08:48569831-48572120 (-)

Description Similar to AFRR: Monodehydroascorbate reductase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g03630`	Catalyzes the conversion of monodehydroascorbate to ascorbate, oxidizing NADH in the process.	No verified direct reference in this release
`At3g52880`	Catalyzes the conversion of monodehydroascorbate to ascorbate, oxidizing NADH in the process.	Arabidopsis peroxisomes possess functionally redundant membrane and matrix isoforms of monodehydroascorbate reductase.2005 · DOI: 10.1111/j.1365-313x.2005.02503.x
`At3g09940`	Catalyzes the conversion of monodehydroascorbate to ascorbate, oxidizing NADH in the process.	Arabidopsis peroxisomes possess functionally redundant membrane and matrix isoforms of monodehydroascorbate reductase.2005 · DOI: 10.1111/j.1365-313x.2005.02503.x Monodehydroascorbate reductase 2 and dehydroascorbate reductase 5 are crucial for a mutualistic interaction between Piriformospora indica and Arabidopsis.2009 · DOI: 10.1016/j.jplph.2008.12.016

Rice

Reference gene ID	Possible function	Papers / DOI
`Os09g0567300`	Catalyzes the conversion of monodehydroascorbate to ascorbate, oxidizing NADH in the process.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_003711 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0042744 hydrogen peroxide catabolic process Biological Process

GO:0098869 cellular oxidant detoxification Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005777 peroxisome Cellular Component

GO:0005782 peroxisomal matrix Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0048046 apoplast Cellular Component

GO:0000166 nucleotide binding Molecular Function

GO:0003729 mRNA binding Molecular Function

GO:0016656 monodehydroascorbate reductase (NADH) activity Molecular Function

KEGG gene cross-reference

ath:AT3G52880

dosa:Os08g0557600

dosa:Os09g0567300

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.612

Rank 1 · TkA08G185820 · TK1151

Nucleus0.220

Rank 2 · TkA08G185820 · TK1151

Mitochondrion0.169

Rank 3 · TkA08G185820 · TK1151

Peroxisome0.133

Rank 4 · TkA08G185820 · TK1151

Plastid0.064

Rank 5 · TkA08G185820 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07992Pyr_redox_24-127 aa

PF00070Pyr_redox6-53 aa

PF04820Trp_halogenase14-69 aa

PF21791MDHAR3-like_C18-51 aa

PF21791MDHAR3-like_C151-238 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G185820	`PF07992`	Pyr_redox_2	4	127	4.9e-21	76.1
TkA08G185820	`PF00070`	Pyr_redox	6	53	0.015	16.6
TkA08G185820	`PF04820`	Trp_halogenase	14	69	0.0095	15.5
TkA08G185820	`PF21791`	MDHAR3-like_C	18	51	1.4e-40	138.0
TkA08G185820	`PF21791`	MDHAR3-like_C	151	238	1.4e-40	138.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q93WJ8`	Arabidopsis thaliana	sp\|Q93WJ8\|MDAR2_ARATH Monodehydroascorbate reductase 2	67.200%	Swiss-Prot	High
`Q9LFA3`	Arabidopsis thaliana	sp\|Q9LFA3\|MDAR1_ARATH Monodehydroascorbate reductase 1, peroxisomal	67.200%	Swiss-Prot	High
`Q9SR59`	Arabidopsis thaliana	sp\|Q9SR59\|MDAR3_ARATH Monodehydroascorbate reductase 3	68.000%	Swiss-Prot	High
`Q652L6`	Oryza sativa subsp. japonica	sp\|Q652L6\|MDAR3_ORYSJ Monodehydroascorbate reductase 3, cytosolic	69.800%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card