TkA08G154850 | RubberDandelionOmics

Gene overview

TkA08G154850

Reference: TK1151 Chr: Chr08 Coordinates: 40423422-40428822 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

4402 bp · TkA08G154850|TK1151|cDNA

CAATATATTTAACACAGGTAATTTAAGCCTACATGTTTAAAGGTAAAACAACAAATGAATGGAGGCGGTGGTATGGTTTTGAAAACTGAAGTATAGTGACGGTGTCGTTTCGTAGTCAATGGCTCGATTCGCTTCTTTTAACATTTTTATCAGCTCTCCACCTTCGCAAGAAATTGGCGGCAACAATTGACGGAATCGTTGATCTTCGAAGGAGAATATGGGCGTCCACGGTCTTTGGGATCTGTTATCCCCCGTTGGTC...

CDS

Download CDS FASTA

3924 bp · TkA08G154850|TK1151|CDS

ATGGGCGTCCACGGTCTTTGGGATCTGTTATCCCCCGTTGGTCGCCGTGTCTCAGTTGAAACCCTCGCCGGCAAAAGACTCGCAATTGATGCGAGCATATGGATGGTACAGTTCATGAAGGCGATGAGAGATGAACGCGGAGAGATGGTGAGGAATGCACACATATTAGGGTTTTTCCGACGAATTTGCAAGCTATTGTTTCTACGGACGAAACCAGTGTTTGTTTTTGATGGTGCCACACCTGCTTTAAAACGGAGAAC...

Protein

Download Protein FASTA

1307 aa · TkA08G154850|TK1151|PROTEIN

MGVHGLWDLLSPVGRRVSVETLAGKRLAIDASIWMVQFMKAMRDERGEMVRNAHILGFFRRICKLLFLRTKPVFVFDGATPALKRRTVIARRRQRENAQTKIRKTAEKLLLNHLKAMRLKELANDLENQRKNNGDKGKGVITDKSDLAGTTSKTNPPDTKGFDQEALDAMLAASIDAEENKGIIGDASTSGAGVSAEDEDEDDDDEEMLLPTLDGKVDPAVLASLPPSMQLDLLSQMRERLMAENRQKYQKVKKAPARFS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G154850`
TK1151 ID	TkA08G154850
OH-1004 ID	LXL04_013305
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	98.800
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G154850

Location Chr08:40423422-40428822 (+)

Description Similar to UVH3: DNA repair protein UVH3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g28030`	Putative single-stranded DNA endonuclease involved in nucleotide excision repair (NER) of UV- and oxidative damaged DNA.	Arabidopsis UVH3 gene is a homolog of the Saccharomyces cerevisiae RAD2 and human XPG DNA repair genes.2001 · DOI: 10.1046/j.1365-313x.2001.01031.x

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_013305 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000724 double-strand break repair via homologous recombination Biological Process

GO:0006281 DNA repair Biological Process

GO:0006283 transcription-coupled nucleotide-excision repair Biological Process

GO:0006285 base-excision repair, AP site formation Biological Process

GO:0006289 nucleotide-excision repair Biological Process

GO:0008340 determination of adult lifespan Biological Process

GO:0009408 response to heat Biological Process

GO:0009411 response to UV Biological Process

GO:0009650 UV protection Biological Process

GO:0010213 non-photoreactive DNA repair Biological Process

GO:0010225 response to UV-C Biological Process

GO:0035264 multicellular organism growth Biological Process

KEGG gene cross-reference No functional description available

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.950

Rank 1 · TkA08G154850 · TK1151

Cytoplasm0.131

Rank 2 · TkA08G154850 · TK1151

Mitochondrion0.022

Rank 3 · TkA08G154850 · TK1151

Cell membrane0.018

Rank 4 · TkA08G154850 · TK1151

Endoplasmic reticulum0.008

Rank 5 · TkA08G154850 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00752XPG_N1-97 aa

PF14377UBM217-242 aa

PF12813XPG_I_2317-360 aa

PF00752XPG_N393-425 aa

PF14377UBM726-734 aa

PF00700Flagellin_C741-771 aa

PF12813XPG_I_2779-864 aa

PF00867XPG_I786-867 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G154850	`PF00752`	XPG_N	1	97	3.7e-30	105.1
TkA08G154850	`PF14377`	UBM	217	242	0.00019	21.5
TkA08G154850	`PF12813`	XPG_I_2	317	360	2.8e-06	27.8
TkA08G154850	`PF00752`	XPG_N	393	425	3.7e-30	105.1
TkA08G154850	`PF14377`	UBM	726	734	0.00019	21.5
TkA08G154850	`PF00700`	Flagellin_C	741	771	0.093	13.8
TkA08G154850	`PF12813`	XPG_I_2	779	864	2.8e-06	27.8
TkA08G154850	`PF00867`	XPG_I	786	867	1e-26	93.8
TkA08G154850	`PF14377`	UBM	879	890	0.00019	21.5
TkA08G154850	`PF12813`	XPG_I_2	959	1015	2.8e-06	27.8
TkA08G154850	`PF25698`	EBNA2_Core	1095	1112	0.92	9.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ATY5`	Arabidopsis thaliana	sp\|Q9ATY5\|UVH3_ARATH DNA repair protein UVH3	48.400%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card