RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA08G153030
Reference: TK1151 Chr: Chr08 Coordinates: 39903273-39908253 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

3207 bp · TkA08G153030|TK1151|cDNA

AATCAAAAAGATTGATACACTAGATGGATACAGACATGAAATGAGGTAACAACAAATCCAAACAGTCTATCTTTTTAGTTTACCCCACTCACTTTCCTCTTTTCAGACTAGGGTTTTCTTAAAAACTCCTGAAAATTCCTTTTCAAAGAATCTCTTTCCCCAAAGATCCTCCATTTACTCCTCTACCTTCATCATATTTGGCCGTAGAAAATGAAATCTCTATGTGCTCCTATGGTATACAAGTAAACGATTCAAGAAAT...

CDS

Download CDS FASTA

2589 bp · TkA08G153030|TK1151|CDS

ATGATGTCGACCTCCTGCAAGGATGGTGTCGACGGAAAATATGTCCGATACACACCGGAGCAGGTCGAAGCACTTGAAAGACTCTACCATGACTGTCCAAAACCCAGTTCTCTCCGCCGTCAGCAGCTCATTCGCGAATGCCCAATTCTCTCCAACATCGAGCCCAAACAAATCAAAGTCTGGTTTCAGAATCGAAGGTACCCGTTACACATCCACAATCAACAAAATCACACATCTTTCGTTTCATACCACCATTTTAC...

Protein

Download Protein FASTA

862 aa · TkA08G153030|TK1151|PROTEIN

MMSTSCKDGVDGKYVRYTPEQVEALERLYHDCPKPSSLRRQQLIRECPILSNIEPKQIKVWFQNRRYPLHIHNQQNHTSFVSYHHFTVMISGFFRCREKQRKEASRLQTVNRKLSAMNKLLMEENDRLQKQVSHLVYENGCFRQHTPNNALATKDTSCESVVTNAQHRLTTKHPPRDASPAGLLSIAEETLTEFLSKATGTAIEWVQMPGMKPGPDSIGIVAISHGCTGVAARACGLVALEPSRVAEILKDRTSWYRDCR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA08G153030
TK1151 IDTkA08G153030
OH-1004 IDLXL04_032148
Relationship / confidenceMulti Source To Oh1004 / Complex relationship
Protein identity (%)96.200
Protein coverage (%)TK1151 100.000 / OH-1004 100.000
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA08G153030
LocationChr08:39903273-39908253 (+)
DescriptionSimilar to ATHB-15: Homeobox-leucine zipper protein ATHB-15
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At1g52150 Probable transcription factor involved in the regulation of meristem development to promote lateral organ formation.
Mutations in the microRNA complementarity site of the INCURVATA4 gene perturb meristem function and adaxialize lateral organs in arabidopsis.2006 · DOI: 10.1104/pp.106.077149
At4g32880 Probable transcription factor involved in the regulation of vascular development.
The arabidopsis ATHB-8 HD-zip protein acts as a differentiation-promoting transcription factor of the vascular meristems.2001 · DOI: 10.1104/pp.126.2.643

Rice

Reference gene IDPossible functionPapers / DOI
Os03g0640800 Probable transcription factor. No verified direct reference in this release
UniProt: A2XK30 Probable transcription factor. No verified direct reference in this release
UniProt: A2ZMN9 Probable transcription factor. No verified direct reference in this release
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_032148 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006351 DNA-templated transcription Biological Process
GO:0008284 positive regulation of cell population proliferation Biological Process
GO:0009733 response to auxin Biological Process
GO:0009855 determination of bilateral symmetry Biological Process
GO:0009965 leaf morphogenesis Biological Process
GO:0010014 meristem initiation Biological Process
GO:0010067 procambium histogenesis Biological Process
GO:0010072 primary shoot apical meristem specification Biological Process
GO:0010073 meristem maintenance Biological Process
GO:0010075 regulation of meristem growth Biological Process
GO:0010087 phloem or xylem histogenesis Biological Process
GO:0010089 xylem development Biological Process
KEGG gene cross-reference
ath:AT1G52150
ath:AT4G32880
dosa:Os03g0640800
dosa:Os12g0612700
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.564
Rank 1 · TkA08G153030 · TK1151
Cytoplasm0.325
Rank 2 · TkA08G153030 · TK1151
Cell membrane0.110
Rank 3 · TkA08G153030 · TK1151
Endoplasmic reticulum0.063
Rank 4 · TkA08G153030 · TK1151
Plastid0.047
Rank 5 · TkA08G153030 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00046Homeodomain13-66 aa
PF05920Homeobox_KN32-66 aa
PF30681ZPR90-139 aa
PF00170bZIP_195-135 aa
PF24237INO80E127-144 aa
PF01852START186-394 aa
PF25797PDF2_C334-346 aa
PF25797PDF2_C413-505 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA08G153030PF00046Homeodomain13664.3e-1452.8
TkA08G153030PF05920Homeobox_KN32660.212.2
TkA08G153030PF30681ZPR901390.01116.7
TkA08G153030PF00170bZIP_1951350.009116.8
TkA08G153030PF24237INO80E1271440.2312.5
TkA08G153030PF01852START1863943e-50171.2
TkA08G153030PF25797PDF2_C3343460.000122.2
TkA08G153030PF25797PDF2_C4135050.000122.2
TkA08G153030PF25797PDF2_C6526980.000122.2
TkA08G153030PF08670MEKHLA7208618.2e-45152.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9ZU11Arabidopsis thalianasp|Q9ZU11|ATB15_ARATH Homeobox-leucine zipper protein ATHB-1578.900%Swiss-ProtHigh
Q39123Arabidopsis thalianasp|Q39123|ATHB8_ARATH Homeobox-leucine zipper protein ATHB-874.700%Swiss-ProtHigh
Q6AST1Oryza sativa subsp. japonicasp|Q6AST1|HOX32_ORYSJ Homeobox-leucine zipper protein HOX3268.600%Swiss-ProtHigh
A2XK30Oryza sativa subsp. indicasp|A2XK30|HOX32_ORYSI Homeobox-leucine zipper protein HOX3268.600%Swiss-ProtHigh
A2ZMN9Oryza sativa subsp. indicasp|A2ZMN9|HOX33_ORYSI Homeobox-leucine zipper protein HOX3366.300%Swiss-ProtHigh

JBrowse

View in Genome Browser