TkA08G139950 | RubberDandelionOmics

Gene overview

TkA08G139950

Reference: TK1151 Chr: Chr08 Coordinates: 36383141-36385557 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1972 bp · TkA08G139950|TK1151|cDNA

CTGTTAGTACATCACTCGTGTTAAATGATTAAACCAAGTCGACGCAATTCCTCCATGAGGACCTCATCAACAAACGATCATCAGAAAATTTGGATCTGATTTGTTTGGATCAAATCAGATCATAAGAAGATCTTCGGTGAAGTTTCATCTCTTTACGTTATGGAAGAAAGCAAACAGAGAATGCATTGTTCGATTTTGTTTACTGCGCTTTTGATATGTTGTTTCATTTCGCATACATGTTCTTCTTCTGATGACATTAC...

CDS

Download CDS FASTA

1614 bp · TkA08G139950|TK1151|CDS

ATGGAAGAAAGCAAACAGAGAATGCATTGTTCGATTTTGTTTACTGCGCTTTTGATATGTTGTTTCATTTCGCATACATGTTCTTCTTCTGATGACATTACATTTTACGAGTCATTCGATGAATCTTTTGAAGGGAGGTGGATCGTATCTAAGAAGAACGAAGCTTATTCAGGTCTATGGAAACACTCGAAAAGTGAAGGGCATGAAGATTACGGGCTTCTCGTGAGTGAAAAGGCTAAAAAATACGCAATTGTGAAGGA...

Protein

Download Protein FASTA

537 aa · TkA08G139950|TK1151|PROTEIN

MEESKQRMHCSILFTALLICCFISHTCSSSDDITFYESFDESFEGRWIVSKKNEAYSGLWKHSKSEGHEDYGLLVSEKAKKYAIVKELEKPLDLKDTTTVLQFEVRFQNGLECGGAYLKYLRPQESGWTAKLFNNESPYSIMFGPDKCGATNKVHFILKHKNPINGEYTEHHLISPPSVPLDKLTHVYTAILNSGNNEVRILVDGEEKKKANFLSPEDFQPSLIPEKTIPDPDDKKPEDWDERAKIPDPDAVKPEDWDEN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G139950`
TK1151 ID	TkA08G139950
OH-1004 ID	LXL04_009261
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	66.300
Protein coverage (%)	TK1151 89.944 / OH-1004 87.884 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G139950

Location Chr08:36383141-36385557 (+)

Description Similar to CNX1: Calnexin homolog 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g61790`	Calcium-binding protein that interacts with newly synthesized monoglucosylated glycoproteins in the endoplasmic reticulum.	No verified direct reference in this release
`At5g07340`	Calcium-binding protein that interacts with newly synthesized monoglucosylated glycoproteins in the endoplasmic reticulum.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_009261 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006457 protein folding Biological Process

GO:0036503 ERAD pathway Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005773 vacuole Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0005509 calcium ion binding Molecular Function

GO:0030246 carbohydrate binding Molecular Function

KEGG gene cross-reference

ath:AT5G07340

ath:AT5G61790

gmx:547851

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.806

Rank 1 · TkA08G139950 · TK1151

Cytoplasm0.120

Rank 2 · TkA08G139950 · TK1151

Golgi apparatus0.094

Rank 3 · TkA08G139950 · TK1151

Nucleus0.093

Rank 4 · TkA08G139950 · TK1151

Cell membrane0.064

Rank 5 · TkA08G139950 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14630ORC5_C14-198 aa

PF01884PcrB27-102 aa

PF00262Calreticulin35-392 aa

PF13385Laminin_G_3153-215 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G139950	`PF14630`	ORC5_C	14	198	0.045	14.7
TkA08G139950	`PF01884`	PcrB	27	102	0.036	14.3
TkA08G139950	`PF00262`	Calreticulin	35	392	1.6e-143	478.8
TkA08G139950	`PF13385`	Laminin_G_3	153	215	0.18	12.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P29402`	Arabidopsis thaliana	sp\|P29402\|CALX1_ARATH Calnexin homolog 1	73.300%	Swiss-Prot	High
`Q38798`	Arabidopsis thaliana	sp\|Q38798\|CALX2_ARATH Calnexin homolog 2	71.000%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card