TkA08G139610 | RubberDandelionOmics

Gene overview

TkA08G139610

Reference: TK1151 Chr: Chr08 Coordinates: 36301699-36305454 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1994 bp · TkA08G139610|TK1151|cDNA

TCTTGATCTATTAGAAATAGATCGGAGAAAAACAAAGGAAGAAGGAACATGACACAAATATAGATATATATATATTTTGTTTCTCCGCTGTTTTACAGCTCTGAGAAATCGAGGAGATTCTGTTTCCTAATTGGGCTAGGCTCCCCAAAATTCTGTTTCCTAATTATGCACAGATTTCATTTCATATCTGTATATGCATAAGTTACGCCGGCAGGATCCTCATAAAGATTTGATTTTTGTTTCAATTCAACCCTTTTCCC...

CDS

Download CDS FASTA

1374 bp · TkA08G139610|TK1151|CDS

ATGGTTCATACACACTTCGTGTGGCCTCACGGAGGCAATCAAGTCTTCCTCTGTGGCGATTTCACTGCGTGGATCAAGTATCAACAGATGGTCACCGTTGAGGGTTCTTCCACGACTTTTATGACGATTTGCGATCTACCACCTGGTTTACACAAGTTCAAATTCTTGGTCGATGGTTTATGGAGGGTCGATGAATTACAACCAATTGCTGAAGATGAGTATGGTGTTAACAATGTCGTTCTTGTGGAACAACCGCAACT...

Protein

Download Protein FASTA

457 aa · TkA08G139610|TK1151|PROTEIN

MVHTHFVWPHGGNQVFLCGDFTAWIKYQQMVTVEGSSTTFMTICDLPPGLHKFKFLVDGLWRVDELQPIAEDEYGVNNVVLVEQPQLMPQTLLVDDGLPVMDIDGYDDRNHAAGASTSGSIPNEAVVELTNDDIETTRRRLFKHFSSYKAYELIPDSGKVFALDDNMTVEEAFLVMHEEGLIVAPLWDAADLQISGMLTASDFIMILIELQRNRAMGTNNVHQLSTISAWKEGKLQLQRRPLIQVGPDDSLSDVAVRILQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G139610`
TK1151 ID	TkA08G139610
OH-1004 ID	LXL04_031979
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G139610

Location Chr08:36301699-36305454 (-)

Description Similar to SNF4: Sucrose nonfermenting 4-like protein

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g09020`	Regulatory subunit of the probable trimeric SNF1-related protein kinase (SnRK) complex, which may play a role in a signal transduction cascade regulating gene expression and carbohydrate metabolism in higher plants.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_031979 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000266 mitochondrial fission Biological Process

GO:0006110 regulation of glycolytic process Biological Process

GO:0006468 protein phosphorylation Biological Process

GO:0006633 fatty acid biosynthetic process Biological Process

GO:0007165 signal transduction Biological Process

GO:0007283 spermatogenesis Biological Process

GO:0009859 pollen hydration Biological Process

GO:0016559 peroxisome fission Biological Process

GO:0031669 cellular response to nutrient levels Biological Process

GO:0042149 cellular response to glucose starvation Biological Process

GO:0045722 positive regulation of gluconeogenesis Biological Process

GO:0046777 protein autophosphorylation Biological Process

KEGG gene cross-reference

ath:AT1G09020

bta:282324

hsa:5571

mmu:19082

ssc:414426

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.537

Rank 1 · TkA08G139610 · TK1151

Cytoplasm0.487

Rank 2 · TkA08G139610 · TK1151

Cell membrane0.085

Rank 3 · TkA08G139610 · TK1151

Lysosome / Vacuole0.070

Rank 4 · TkA08G139610 · TK1151

Endoplasmic reticulum0.050

Rank 5 · TkA08G139610 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF16561AMPK1_CBM3-85 aa

PF00571CBS96-105 aa

PF00571CBS159-207 aa

PF00571CBS239-269 aa

PF00571CBS307-316 aa

PF00571CBS327-374 aa

PF27132XisAC_2nd384-420 aa

PF00571CBS388-401 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G139610	`PF16561`	AMPK1_CBM	3	85	5e-23	81.8
TkA08G139610	`PF00571`	CBS	96	105	3.5e-24	85.6
TkA08G139610	`PF00571`	CBS	159	207	3.5e-24	85.6
TkA08G139610	`PF00571`	CBS	239	269	3.5e-24	85.6
TkA08G139610	`PF00571`	CBS	307	316	3.5e-24	85.6
TkA08G139610	`PF00571`	CBS	327	374	3.5e-24	85.6
TkA08G139610	`PF27132`	XisAC_2nd	384	420	0.22	12.6
TkA08G139610	`PF00571`	CBS	388	401	3.5e-24	85.6
TkA08G139610	`PF00571`	CBS	408	452	3.5e-24	85.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q944A6`	Arabidopsis thaliana	sp\|Q944A6\|SNF4_ARATH Sucrose nonfermenting 4-like protein	43.100%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card