TkA08G137910 | RubberDandelionOmics

Gene overview

TkA08G137910

Reference: TK1151 Chr: Chr08 Coordinates: 35874408-35876426 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1417 bp · TkA08G137910|TK1151|cDNA

TCTAAACATAGCATCACCCATGTGACACACATTCACTTCTTCTCGCTACTCGCAAACACGCTACCCGCTCCCTCATAAATATCCCCTTCTCAATAACCAAAATTCACACTCCAATCTCCACCATGTCAGTTCCCGCATCCACCGTGACGCCGCCGTTGGTCGACGAATTGGACATCGTCATCCCCACCATCAGAAACCTCGATTTCCTCGAGCAGTGGAGACCTTTCTTCCAGCCATACCATCTGATCATCGTCCAAGAT...

CDS

Download CDS FASTA

1089 bp · TkA08G137910|TK1151|CDS

ATGTCAGTTCCCGCATCCACCGTGACGCCGCCGTTGGTCGACGAATTGGACATCGTCATCCCCACCATCAGAAACCTCGATTTCCTCGAGCAGTGGAGACCTTTCTTCCAGCCATACCATCTGATCATCGTCCAAGATGGAGATCCAACGAAGAAGATCCATGTGCCTGAAGGATTCGATTACGAACTCTACAACCGTAACGATATCAATCGGATCCTTGGCCCTAAGTCCAGTTGCATTTCCTTCAAGGATTCCGCTTG...

Protein

Download Protein FASTA

362 aa · TkA08G137910|TK1151|PROTEIN

MSVPASTVTPPLVDELDIVIPTIRNLDFLEQWRPFFQPYHLIIVQDGDPTKKIHVPEGFDYELYNRNDINRILGPKSSCISFKDSACRCFGFLVSKKKYIFTIDDDCFVAKDPTGEQINALAQHIHNLLTPATPFFFNTLYDPYREGADFVRGYPFSLREGAPTAISHGLWLNIPDYDAPTQLVKPRERNTRYVDAVMTIPKQTLFPMCGMNLGFHRELIGPAMYFGLMGDGQPIGRYDDMWAGWCAKVICDHLGLGVKT...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G137910`
TK1151 ID	TkA08G137910
OH-1004 ID	LXL04_013437
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	83.600
Protein coverage (%)	TK1151 96.133 / OH-1004 98.864 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G137910

Location Chr08:35874408-35876426 (-)

Description Similar to UPTG1: Probable UDP-arabinopyranose mutase 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g02230`	UDP-L-arabinose mutase involved in the biosynthesis of cell wall non-cellulosic polysaccharides.	Arabidopsis reversibly glycosylated polypeptides 1 and 2 are essential for pollen development.2006 · DOI: 10.1104/pp.106.086363 The interconversion of UDP-arabinopyranose and UDP-arabinofuranose is indispensable for plant development in Arabidopsis.2011 · DOI: 10.1105/tpc.111.083931
`At5g15650`	UDP-L-arabinose mutase involved in the biosynthesis of cell wall non-cellulosic polysaccharides.	Arabidopsis reversibly glycosylated polypeptides 1 and 2 are essential for pollen development.2006 · DOI: 10.1104/pp.106.086363 The interconversion of UDP-arabinopyranose and UDP-arabinofuranose is indispensable for plant development in Arabidopsis.2011 · DOI: 10.1105/tpc.111.083931

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0599800`	UDP-L-arabinose mutase involved in the biosynthesis of cell wall non-cellulosic polysaccharides.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_013437 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009101 glycoprotein biosynthetic process Biological Process

GO:0030244 cellulose biosynthetic process Biological Process

GO:0033356 UDP-L-arabinose metabolic process Biological Process

GO:0071555 cell wall organization Biological Process

GO:0071669 plant-type cell wall organization or biogenesis Biological Process

GO:0005794 Golgi apparatus Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0016866 intramolecular transferase activity Molecular Function

GO:0052691 UDP-arabinopyranose mutase activity Molecular Function

KEGG gene cross-reference

dosa:Os03g0599800

zma:542592

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.454

Rank 1 · TkA08G137910 · TK1151

Golgi apparatus0.327

Rank 2 · TkA08G137910 · TK1151

Endoplasmic reticulum0.238

Rank 3 · TkA08G137910 · TK1151

Nucleus0.162

Rank 4 · TkA08G137910 · TK1151

Cell membrane0.105

Rank 5 · TkA08G137910 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03214RGP14-346 aa

PF00535Glycos_transf_230-49 aa

PF10111Glyco_tranf_2_238-119 aa

PF00535Glycos_transf_290-139 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G137910	`PF03214`	RGP	14	346	1.8e-178	593.7
TkA08G137910	`PF00535`	Glycos_transf_2	30	49	0.055	14.1
TkA08G137910	`PF10111`	Glyco_tranf_2_2	38	119	0.012	15.8
TkA08G137910	`PF00535`	Glycos_transf_2	90	139	0.055	14.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SRT9`	Arabidopsis thaliana	sp\|Q9SRT9\|RGP1_ARATH UDP-arabinopyranose mutase 1	86.000%	Swiss-Prot	High
`Q9LFW1`	Arabidopsis thaliana	sp\|Q9LFW1\|RGP2_ARATH UDP-arabinopyranose mutase 2	85.100%	Swiss-Prot	High
`Q8H8T0`	Oryza sativa subsp. japonica	sp\|Q8H8T0\|RGP1_ORYSJ UDP-arabinopyranose mutase 1	81.900%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card