Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1235 bp · TkA08G133760|TK1151|cDNA
TATCACAGTATGAATTACTGGATGAAATGATGGACTTTGGATACCCACAATATACCGAAGAAACGATTCTCAGTAAATTTATCAAGACTGGTGCTTATAAGTTGGAAGTTACACAAAGACCTCCAATGGCTGTTACGAATGCAGTCTCATGGAGAAATGAAGGAATATTCTACAAAAAGAATGAAGTGTTCCTGGATGTGATTGAAAGTCTTAACATATTAATCAACAGTAACAGGCAGATAATTCGATCAGAAGTTGTT...
1284 bp · TkA08G133760|TK1151|CDS
ATGTCAGGAGCCGTTTCCGCGCTTTTCATTCTCGATATCAAGGGACGTTGCTTGATCAGTCGTCAATATCGTGGTGACATTTCACCTGGTGAAGCGGAGAGGTTCTTCACCAAACTCCTCGAGAATGAGAAGGATATAGAGTCTCAAGGTCCAGTAGTCTTCGACACTGGTGTCTCTCATATATTCATCCAACACAACAATGTCTACTTAATGGCTGTATCGAGGCAAAACTGTAATGTTGCTAGCCTAATTGTATTTCT...
Protein
Download Protein FASTA427 aa · TkA08G133760|TK1151|PROTEIN
MSGAVSALFILDIKGRCLISRQYRGDISPGEAERFFTKLLENEKDIESQGPVVFDTGVSHIFIQHNNVYLMAVSRQNCNVASLIVFLHRLASVFEYYFGELEEESLRDNFVIVYELLDEMMDFGYPQYTEETILSKFIKTGAYKLEVTQRPPMAVTNAVSWRNEGIFYKKNEVFLDVIESLNILINSNRQIIRSEVVGALKMRTCLSGMPECKLGLNDRVIMDAQSKAKGKSIDLEDIKFHQCVRLARFESDRTISFIPP...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA08G133760 |
|---|---|
| TK1151 ID | TkA08G133760 |
| OH-1004 ID | LXL04_020731 |
| Relationship / confidence | Non Reciprocal Best Hit / Complex relationship |
| Protein identity (%) | 75.200 |
| Protein coverage (%) | TK1151 99.766 / OH-1004 99.766Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA08G133760 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr08:34766096-34769524 (-) | |||||||||
| Description | Similar to AP1M2: AP-1 complex subunit mu-2 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0006886 intracellular protein transport Biological Process GO:0006892 post-Golgi vesicle-mediated transport Biological Process GO:0006896 Golgi to vacuole transport Biological Process GO:0007034 vacuolar transport Biological Process GO:0016192 vesicle-mediated transport Biological Process GO:0032438 melanosome organization Biological Process GO:0035646 endosome to melanosome transport Biological Process GO:0035653 clathrin-coated vesicle cargo loading, AP-1-mediated Biological Process GO:0060155 platelet dense granule organization Biological Process GO:0071280 cellular response to copper ion Biological Process GO:0000139 Golgi membrane Cellular Component GO:0005634 nucleus Cellular Component | |||||||||
| KEGG gene cross-reference | ath:AT1G10730 ath:AT1G60780 bta:504310 hsa:8907 rno:306332 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF01217Clat_adaptor_s5-130 aaPF01217Clat_adaptor_s147-170 aaPF00928Adap_comp_sub159-426 aaPF10291muHD267-414 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA08G133760 | PF01217 | Clat_adaptor_s | 5 | 130 | 7.7e-06 | 26.6 |
| TkA08G133760 | PF01217 | Clat_adaptor_s | 147 | 170 | 7.7e-06 | 26.6 |
| TkA08G133760 | PF00928 | Adap_comp_sub | 159 | 426 | 3.5e-87 | 292.8 |
| TkA08G133760 | PF10291 | muHD | 267 | 414 | 0.0003 | 21.1 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.