LXL04_020731 | RubberDandelionOmics

Gene overview

LXL04_020731

Reference: OH-1004 Chr: Chr04 Coordinates: 107209894-107212473 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1287 bp · LXL04_020731|LXL04_020731|OH1004|cDNA

ATGGCAGGGGCGGCCTCTGCGCTGTTCCTCCTCGACATCAAAGGCCGTGTTCTGGTTTGGCGTGACTACCGTGGCGATGTCTCCGCAGTTCAGGCCGAGCGTTTCTTTTCTAAACTCATAGAAAAAGAGGGTGAACCAGATGCTCAAGATCCTGTTGTGTATGATAATGGTGTCACCTATATGTTCGTACAACACAACAATGTATATCTAATGACTGCATCCAGGCAGAACTGTAATGCCGCTAGCCTTCTCCTCTTTTT...

CDS

Download CDS FASTA

1287 bp · LXL04_020731|LXL04_020731|OH1004|CDS

ATGGCAGGGGCGGCCTCTGCGCTGTTCCTCCTCGACATCAAAGGCCGTGTTCTGGTTTGGCGTGACTACCGTGGCGATGTCTCCGCAGTTCAGGCCGAGCGTTTCTTTTCTAAACTCATAGAAAAAGAGGGTGAACCAGATGCTCAAGATCCTGTTGTGTATGATAATGGTGTCACCTATATGTTCGTACAACACAACAATGTATATCTAATGACTGCATCCAGGCAGAACTGTAATGCCGCTAGCCTTCTCCTCTTTTT...

Protein

Download Protein FASTA

428 aa · LXL04_020731|LXL04_020731|OH1004|PROTEIN

MAGAASALFLLDIKGRVLVWRDYRGDVSAVQAERFFSKLIEKEGEPDAQDPVVYDNGVTYMFVQHNNVYLMTASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEMMDFGYPQYTEAKILSEFIKTDAYRMEVSQRPPMAVTNAVSWRSEGIRYKKNEVFLDVVESVNILVNSNGQIVRSEVVGALKMRTFLSGMPECKLGLNDRLLLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFVP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_020731`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_020731

Location Chr04:107209894-107212473 (-)

Description Similar to AP1M2: AP-1 complex subunit mu-2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g60780`	Subunit of clathrin-associated adaptor protein complex 1 that plays a role in protein sorting at the trans-Golgi network and early endosomes (TGN/EE).	The AP-1 μ adaptin is required for KNOLLE localization at the cell plate to mediate cytokinesis in Arabidopsis.2013 · DOI: 10.1093/pcp/pct048 Arabidopsis μ-adaptin subunit AP1M of adaptor protein complex 1 mediates late secretory and vacuolar traffic and is required for growth.2013 · DOI: 10.1073/pnas.1300460110 HAPLESS13, the Arabidopsis μ1 adaptin, is essential for protein sorting at the trans-Golgi network/early endosome.2013 · DOI: 10.1104/pp.113.221051
`At1g10730`	Subunit of clathrin-associated adaptor protein complex 1 that plays a role in protein sorting at the trans-Golgi network and early endosomes (TGN/EE).	Arabidopsis μ-adaptin subunit AP1M of adaptor protein complex 1 mediates late secretory and vacuolar traffic and is required for growth.2013 · DOI: 10.1073/pnas.1300460110

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_020731 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006886 intracellular protein transport Biological Process

GO:0006892 post-Golgi vesicle-mediated transport Biological Process

GO:0006896 Golgi to vacuole transport Biological Process

GO:0007034 vacuolar transport Biological Process

GO:0016192 vesicle-mediated transport Biological Process

GO:0032438 melanosome organization Biological Process

GO:0035646 endosome to melanosome transport Biological Process

GO:0035653 clathrin-coated vesicle cargo loading, AP-1-mediated Biological Process

GO:0060155 platelet dense granule organization Biological Process

GO:0071280 cellular response to copper ion Biological Process

GO:0000139 Golgi membrane Cellular Component

GO:0005634 nucleus Cellular Component

KEGG gene cross-reference

ath:AT1G10730

ath:AT1G60780

bta:504310

hsa:8907

rno:306332

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.554

Rank 1 · LXL04_020731 · OH-1004

Golgi apparatus0.403

Rank 2 · LXL04_020731 · OH-1004

Cell membrane0.212

Rank 3 · LXL04_020731 · OH-1004

Nucleus0.132

Rank 4 · LXL04_020731 · OH-1004

Endoplasmic reticulum0.105

Rank 5 · LXL04_020731 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01217.27Clat_adaptor_s7-131 aa

PF00928.27Adap_comp_sub159-426 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_020731	`PF01217.27`	Clat_adaptor_s	7	131	1.9e-07	31.9
LXL04_020731	`PF00928.27`	Adap_comp_sub	159	426	9.4e-96	320.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O22715`	Arabidopsis thaliana	AP-1 complex subunit mu-2	90.421%	Swiss-Prot	strong database homology
`Q9SAC9`	Arabidopsis thaliana	AP-1 complex subunit mu-1	85.981%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card