RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA08G125780
Reference: TK1151 Chr: Chr08 Coordinates: 32675311-32675921 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

350 bp · TkA08G125780|TK1151|cDNA

AAGATACCATGGAGGGTGTTGTGTACTCTACATCTAACTTTGGGCTTGATGAAAGATTTGGAGATGGTGATGCATGTGGTTTGGACCTTGATGAGGAATTAATGGTGGAGAAGGCCGAACATGCAATTGAGACATCAAATTCAGAGGTGATGCCAGTGCCAGCTGGCAACATTGTAAATAATCAGCAGATAGAAGAGTATGATGGAGAGAATGAACCAATCGAGTATGCACATGCTCCATGTACACCTGGACTTTGGGAA...

CDS

Download CDS FASTA

342 bp · TkA08G125780|TK1151|CDS

ATGGAGGGTGTTGTGTACTCTACATCTAACTTTGGGCTTGATGAAAGATTTGGAGATGGTGATGCATGTGGTTTGGACCTTGATGAGGAATTAATGGTGGAGAAGGCCGAACATGCAATTGAGACATCAAATTCAGAGGTGATGCCAGTGCCAGCTGGCAACATTGTAAATAATCAGCAGATAGAAGAGTATGATGGAGAGAATGAACCAATCGAGTATGCACATGCTCCATGTACACCTGGACTTTGGGAAGAACCAAA...

Protein

Download Protein FASTA

114 aa · TkA08G125780|TK1151|PROTEIN

MEGVVYSTSNFGLDERFGDGDACGLDLDEELMVEKAEHAIETSNSEVMPVPAGNIVNNQQIEEYDGENEPIEYAHAPCTPGLWEEPNLSNIQETSAYDDHQEPENHTITESAVK

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA08G125780
TK1151 IDTkA08G125780
OH-1004 IDLXL04_012734
Relationship / confidenceSequence Supported Annotation Or Model Conflict / Review
Protein identity (%)99.100
Protein coverage (%)TK1151 100.000 / OH-1004 9.421
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA08G125780
LocationChr08:32675311-32675921 (-)
DescriptionSimilar to SYN4: Sister chromatid cohesion 1 protein 4
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At5g16270 Involved in sister chromatid and centromere cohesion during mitosis.
Cohesin gene defects may impair sister chromatid alignment and genome stability in Arabidopsis thaliana.2009 · DOI: 10.1007/s00412-009-0220-x

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_012734 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0000278 mitotic cell cycle Biological Process
GO:0006302 double-strand break repair Biological Process
GO:0007059 chromosome segregation Biological Process
GO:0007062 sister chromatid cohesion Biological Process
GO:0009555 pollen development Biological Process
GO:0009561 megagametogenesis Biological Process
GO:0051301 cell division Biological Process
GO:0070601 centromeric sister chromatid cohesion Biological Process
GO:1990414 replication-born double-strand break repair via sister chromatid exchange Biological Process
GO:0000775 chromosome, centromeric region Cellular Component
GO:0005634 nucleus Cellular Component
GO:0005730 nucleolus Cellular Component
KEGG gene cross-reference
ath:AT3G59550
ath:AT5G16270
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.706
Rank 1 · TkA08G125780 · TK1151
Cytoplasm0.405
Rank 2 · TkA08G125780 · TK1151
Cell membrane0.045
Rank 3 · TkA08G125780 · TK1151
Mitochondrion0.043
Rank 4 · TkA08G125780 · TK1151
Golgi apparatus0.028
Rank 5 · TkA08G125780 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q8W1Y0Arabidopsis thalianasp|Q8W1Y0|SSC14_ARATH Sister chromatid cohesion 1 protein 443.100%Swiss-ProtMedium

JBrowse

View in Genome Browser