TkA08G125620 | RubberDandelionOmics

Gene overview

TkA08G125620

Reference: TK1151 Chr: Chr08 Coordinates: 32639164-32640810 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1135 bp · TkA08G125620|TK1151|cDNA

ATGTACGAGTCGTGGCTCGTTAAACACGGTAAATTTTACAACGCACTTGGGGAGAAGGAGAGGAGGTTTCAGATCTTCAAAGATAACCTCAGGTACATAGAAGAGCACAACTCCGGCAAGCATTCCTATAAGCTTGGACTCAACAAGTTCGCAGATCTGACCGATGAAGAGTTCCGGTTAGGATACACCAGAGCCATTCCGCAGCTGAAGTCGAACGACGTGAAGAGCGATCGTTATTCTCTCCGTTCTGGTGATGTCCT...

CDS

Download CDS FASTA

915 bp · TkA08G125620|TK1151|CDS

ATGTACGAGTCGTGGCTCGTTAAACACGGTAAATTTTACAACGCACTTGGGGAGAAGGAGAGGAGGTTTCAGATCTTCAAAGATAACCTCAGGTACATAGAAGAGCACAACTCCGGCAAGCATTCCTATAAGCTTGGACTCAACAAGTTCGCAGATCTGACCGATGAAGAGTTCCGGTTAGGATACACCAGAGCCATTCCGCAGCTGAAGTCGAACGACGTGAAGAGCGATCGTTATTCTCTCCGTTCTGGTGATGTCCT...

Protein

Download Protein FASTA

304 aa · TkA08G125620|TK1151|PROTEIN

MYESWLVKHGKFYNALGEKERRFQIFKDNLRYIEEHNSGKHSYKLGLNKFADLTDEEFRLGYTRAIPQLKSNDVKSDRYSLRSGDVLPDSVDWRSKGAVTPVKTQGKCGASWAFSAIGAVEGINQIATGNLITLSEQHLIDCDKVNYGCDGGFITDAYDFIIKNGGISSEKDYPYTAKDGTCDSSKVQDNFVTIDSYGYLLEDNEAALQKAVANQPISAGIDINNTDFKLYESGIFSGSCGHLVNHGIVVVGYGSENGRD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G125620`
TK1151 ID	TkA08G125620
OH-1004 ID	LXL04_008086
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	59.900
Protein coverage (%)	TK1151 99.671 / OH-1004 66.450 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G125620

Location Chr08:32639164-32640810 (+)

Description Similar to RD21A: Cysteine proteinase RD21A

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g19390`	Probable thiol protease.	No verified direct reference in this release
`At3g19400`	Probable thiol protease.	No verified direct reference in this release
`At1g47128`	Cysteine protease that plays a role in immunity, senescence, and biotic and abiotic stresses (Probable).	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os04g0650000`	Oryzain alpha chain.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_008086 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006508 proteolysis Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0016567 protein ubiquitination Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0051603 proteolysis involved in protein catabolic process Biological Process

GO:0090333 regulation of stomatal closure Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0000932 P-body Cellular Component

GO:0005576 extracellular region Cellular Component

GO:0005615 extracellular space Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

KEGG gene cross-reference

ath:AT1G47128

ath:AT5G43060

dosa:Os04g0670200

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Lysosome / Vacuole0.479

Rank 1 · TkA08G125620 · TK1151

Cytoplasm0.253

Rank 2 · TkA08G125620 · TK1151

Extracellular0.249

Rank 3 · TkA08G125620 · TK1151

Endoplasmic reticulum0.108

Rank 4 · TkA08G125620 · TK1151

Cell membrane0.077

Rank 5 · TkA08G125620 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08246Inhibitor_I292-58 aa

PF00112Peptidase_C187-300 aa

PF03051Peptidase_C1_2101-120 aa

PF20800Xp10_P7141-168 aa

PF03051Peptidase_C1_2243-288 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G125620	`PF08246`	Inhibitor_I29	2	58	8.1e-23	81.2
TkA08G125620	`PF00112`	Peptidase_C1	87	300	3.9e-79	266.5
TkA08G125620	`PF03051`	Peptidase_C1_2	101	120	0.00046	19.9
TkA08G125620	`PF20800`	Xp10_P7	141	168	0.017	16.0
TkA08G125620	`PF03051`	Peptidase_C1_2	243	288	0.00046	19.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LT78`	Arabidopsis thaliana	sp\|Q9LT78\|RD21C_ARATH Probable cysteine protease RD21C	57.300%	Swiss-Prot	High
`Q9LT77`	Arabidopsis thaliana	sp\|Q9LT77\|RDL2_ARATH Probable cysteine protease RDL2	55.300%	Swiss-Prot	High
`P43297`	Arabidopsis thaliana	sp\|P43297\|RD21A_ARATH Cysteine proteinase RD21A	58.700%	Swiss-Prot	High
`P25776`	Oryza sativa subsp. japonica	sp\|P25776\|ORYA_ORYSJ Oryzain alpha chain	56.700%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card