LXL04_008086 | RubberDandelionOmics

Gene overview

LXL04_008086

Reference: OH-1004 Chr: Chr02 Coordinates: 85042036-85043922 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1389 bp · LXL04_008086|LXL04_008086|OH1004|cDNA

ATGAAGGTCGCATCCATGGCTATCCTCTTTCTTTTTGCTCTTTTCGCTGTCTCATCGGCCCTCGATATGTCGATCATCGGCTACGATGCCTCCCACATGACTTCCGGCGATTCTAACTGGCGTAGTGACGACGAAGTCAATGCTATGTACGAGTCATGGCTTGTGAAACACGGTAAAGCGTACAACGCTATTGGAGAAAAGGACAAGAGGTTTCAGATCTTCAAGGATAACCTCAGGTTCATCGACGACCATAACTCCGG...

CDS

Download CDS FASTA

1389 bp · LXL04_008086|LXL04_008086|OH1004|CDS

ATGAAGGTCGCATCCATGGCTATCCTCTTTCTTTTTGCTCTTTTCGCTGTCTCATCGGCCCTCGATATGTCGATCATCGGCTACGATGCCTCCCACATGACTTCCGGCGATTCTAACTGGCGTAGTGACGACGAAGTCAATGCTATGTACGAGTCATGGCTTGTGAAACACGGTAAAGCGTACAACGCTATTGGAGAAAAGGACAAGAGGTTTCAGATCTTCAAGGATAACCTCAGGTTCATCGACGACCATAACTCCGG...

Protein

Download Protein FASTA

462 aa · LXL04_008086|LXL04_008086|OH1004|PROTEIN

MKVASMAILFLFALFAVSSALDMSIIGYDASHMTSGDSNWRSDDEVNAMYESWLVKHGKAYNAIGEKDKRFQIFKDNLRFIDDHNSGDHSYKLGLNKFADLTNEEYRKTYTGIKTIDAKKKLSKAKSDRYASSPSDDLPESIDWRAKGAVAAVKDQGSCGSCWAFSTTGSVEGINQIVTGDLISVSEQELVDCDTSYNEGCNGGLMDYAFQFIIKNGGIDTEQDYPYTGRDGKCDTYRKNAKVVSIDGYEDVPENDESAL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_008086`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_008086

Location Chr02:85042036-85043922 (-)

Description Similar to RD21A: Cysteine proteinase RD21A

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g47128`	Cysteine protease that plays a role in immunity, senescence, and biotic and abiotic stresses (Probable).	No verified direct reference in this release
`At5g43060`	Probable thiol protease.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os04g0650000`	Oryzain alpha chain.	No verified direct reference in this release
`Os04g0670200`	Probable thiol protease.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_008086 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006508 proteolysis Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0016567 protein ubiquitination Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0051603 proteolysis involved in protein catabolic process Biological Process

GO:0090333 regulation of stomatal closure Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0000932 P-body Cellular Component

GO:0005576 extracellular region Cellular Component

GO:0005615 extracellular space Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

KEGG gene cross-reference

ath:AT1G47128

ath:AT5G43060

dosa:Os04g0670200

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Lysosome / Vacuole0.597

Rank 1 · LXL04_008086 · OH-1004

Extracellular0.243

Rank 2 · LXL04_008086 · OH-1004

Cytoplasm0.166

Rank 3 · LXL04_008086 · OH-1004

Endoplasmic reticulum0.110

Rank 4 · LXL04_008086 · OH-1004

Cell membrane0.094

Rank 5 · LXL04_008086 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08246.18Inhibitor_I2950-106 aa

PF00112.30Peptidase_C1138-353 aa

PF00396.24Granulin387-433 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_008086	`PF08246.18`	Inhibitor_I29	50	106	1.7e-21	77.0
LXL04_008086	`PF00112.30`	Peptidase_C1	138	353	1.5e-87	294.0
LXL04_008086	`PF00396.24`	Granulin	387	433	4.9e-09	36.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P43297`	Arabidopsis thaliana	Cysteine proteinase RD21A	69.281%	Swiss-Prot	strong database homology
`Q9FMH8`	Arabidopsis thaliana	Probable cysteine protease RD21B	68.667%	Swiss-Prot	strong database homology
`P25776`	Oryza sativa subsp. japonica	Oryzain alpha chain	67.506%	Swiss-Prot	strong database homology
`P25777`	Oryza sativa subsp. japonica	Oryzain beta chain	60.045%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card