TkA08G121270 | RubberDandelionOmics

Gene overview

TkA08G121270

Reference: TK1151 Chr: Chr08 Coordinates: 31549326-31554494 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

4002 bp · TkA08G121270|TK1151|cDNA

GTCGGATTGCCAAGACACTACTTGGAACCATAGGAAGAATACCACATTTTTATGATAATAGAAGGGCGTGAGTGTTAGTCTAGAGAAATTAAAGGACTATAATGTAACTTACCATGGGACGGAAAAATTAGATGCCGCGGACGAAAAGCGACTCCATCGACACCTCTTTAAGGCGTTCGTCTATGCCATCTCTTTCCCCCATTTTGCGCAGATTCTTCCATCTTGTCTTGAATTTTCTATTAGAATGCTCCGTTGTCTAT...

CDS

Download CDS FASTA

3516 bp · TkA08G121270|TK1151|CDS

ATGCTCCGTTGTCTATCTGCTAGTAGAACCACCGTCAACCGCCATCATCGCCACCTATCTAACTGTTTTGCCCGTCGCTTCTTGTCTGCCAATCCTTCCGATCGTAACTCTAAAAGTTTAACCGATTACCAGCAAGACCTCAACAGTTCACAAGATGCTCTTCCCCCACCGCCATTAGTTCTTCACCGACTCCGTCCTAGGGCTCTGTCTCCTCTATCTTACACTTCCCGCTTTGCCGTATCCGCGACCGTAATTTCCGC...

Protein

Download Protein FASTA

1171 aa · TkA08G121270|TK1151|PROTEIN

MLRCLSASRTTVNRHHRHLSNCFARRFLSANPSDRNSKSLTDYQQDLNSSQDALPPPPLVLHRLRPRALSPLSYTSRFAVSATVISAAAVLAASYVVIFDDSEIKEEQAKKKRLLDDFEHAIDRSKESLKRVVNTMKHTGVAASVLWKSLRSVLSSANHEVRSGFEVRVAALLADIVAASESRRAAIVGAGGGVVLDWLLESVALSGGGNYATQAESARALAYLIADPNVCESVLGRPHAIPNLLRFIFFAQPHQSKKQP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G121270`
TK1151 ID	TkA08G121270
OH-1004 ID	LXL04_008174
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	60.400
Protein coverage (%)	TK1151 98.463 / OH-1004 98.468 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA08G121270`
Location	Chr08:31549326-31554494 (-)
Description	Similar to SERAC1: Protein SERAC1
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_008174` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0008654 phospholipid biosynthetic process Biological Process GO:0030198 extracellular matrix organization Biological Process GO:0032367 intracellular cholesterol transport Biological Process GO:0036148 phosphatidylglycerol acyl-chain remodeling Biological Process GO:0005739 mitochondrion Cellular Component GO:0005741 mitochondrial outer membrane Cellular Component GO:0005783 endoplasmic reticulum Cellular Component GO:0005789 endoplasmic reticulum membrane Cellular Component GO:0016020 membrane Cellular Component GO:0031012 extracellular matrix Cellular Component GO:0031966 mitochondrial membrane Cellular Component GO:0044233 mitochondria-associated endoplasmic reticulum membrane contact site Cellular Component
KEGG gene cross-reference	bta:519860 hsa:84947 mmu:321007 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.356

Rank 1 · TkA08G121270 · TK1151

Mitochondrion0.214

Rank 2 · TkA08G121270 · TK1151

Nucleus0.175

Rank 3 · TkA08G121270 · TK1151

Cytoplasm0.126

Rank 4 · TkA08G121270 · TK1151

Endoplasmic reticulum0.091

Rank 5 · TkA08G121270 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF29675Kk1D_N86-141 aa

PF16088BORCS7104-152 aa

PF00514Arm209-225 aa

PF00514Arm407-413 aa

PF29675Kk1D_N459-499 aa

PF16088BORCS7466-489 aa

PF00514Arm485-498 aa

PF00514Arm574-591 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G121270	`PF29675`	Kk1D_N	86	141	0.22	12.8
TkA08G121270	`PF16088`	BORCS7	104	152	0.38	11.7
TkA08G121270	`PF00514`	Arm	209	225	5.3	8.0
TkA08G121270	`PF00514`	Arm	407	413	5.3	8.0
TkA08G121270	`PF29675`	Kk1D_N	459	499	0.22	12.8
TkA08G121270	`PF16088`	BORCS7	466	489	0.38	11.7
TkA08G121270	`PF00514`	Arm	485	498	5.3	8.0
TkA08G121270	`PF00514`	Arm	574	591	5.3	8.0
TkA08G121270	`PF16088`	BORCS7	610	636	0.38	11.7
TkA08G121270	`PF00514`	Arm	723	741	5.3	8.0
TkA08G121270	`PF29675`	Kk1D_N	782	826	0.22	12.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card