TkA08G112520 | RubberDandelionOmics

Gene overview

TkA08G112520

Reference: TK1151 Chr: Chr08 Coordinates: 29269383-29281430 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2950 bp · TkA08G112520|TK1151|cDNA

TCTCCCAGCATTCTTCTTTTGGCGCAACTTTCCAATCTTAACGGCCATAATTTTAACCCATTTACGTTTTAGTTTGTGAGAGAGAGAAAAAGTAGAGAGGAGAGAGAGGTGCATCAATGGCGGACTCAACAGACGGTTCTTCTAGTTTCTGGACTCAAGTTGACGCTTTGTTCAGAAAGAATTTGACCTTTCAGAGAAGGAATTTGAAGACAAATATCAGGCTCGTATTATTCCCAGTCTTCCTCTGTTTATTACTCGTA...

CDS

Download CDS FASTA

1836 bp · TkA08G112520|TK1151|CDS

ATGGCGGACTCAACAGACGGTTCTTCTAGTTTCTGGACTCAAGTTGACGCTTTGTTCAGAAAGAATTTGACCTTTCAGAGAAGGAATTTGAAGACAAATATCAGGCTCGTATTATTCCCAGTCTTCCTCTGTTTATTACTCGTACTACTCGAAAAAATAGTCAACATTGAACTAGATAAACCCTCCTTAAAATGTGGTTGCACTTGTATTGATCAAGATGGAAATGGTGAATGCGAGAGAGTATGCGGGATTGAGTACTC...

Protein

Download Protein FASTA

611 aa · TkA08G112520|TK1151|PROTEIN

MADSTDGSSSFWTQVDALFRKNLTFQRRNLKTNIRLVLFPVFLCLLLVLLEKIVNIELDKPSLKCGCTCIDQDGNGECERVCGIEYSDLKQVSTCSIPSPPEWPPFLQIPAPEYRAVKTDFLPFGDLPNDSCKSTGSCPTTLLITGNNQSLGESLARNMFPISSNFNSSHGLADVVLGSASKTQVSNILEPAFFSNLPVYYVQTHCGAKSSFNMSVPVGSTEVDKEIRCVEGQHLWRNSSSDINNELYTGYRRGNSEDKI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G112520`
TK1151 ID	TkA08G112520
OH-1004 ID	LXL04_031361
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	97.400
Protein coverage (%)	TK1151 94.926 / OH-1004 48.793 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G112520

Location Chr08:29269383-29281430 (+)

Description Similar to ABCA7: ABC transporter A family member 7

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g47780`	ABC transporter A family member 7.	No verified direct reference in this release
`At3g47760`	ABC transporter A family member 5.	No verified direct reference in this release
`At3g47740`	ABC transporter A family member 3.	No verified direct reference in this release
`At3g47790`	ABC transporter A family member 8.	No verified direct reference in this release
`At3g47750`	ABC transporter A family member 4.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_031361 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006869 lipid transport Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0016020 membrane Cellular Component

GO:0005319 lipid transporter activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0016887 ATP hydrolysis activity Molecular Function

GO:0042626 ATPase-coupled transmembrane transporter activity Molecular Function

GO:0140359 ABC-type transporter activity Molecular Function

KEGG gene cross-reference

ath:AT3G47740

ath:AT3G47760

ath:AT3G47780

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.379

Rank 1 · TkA08G112520 · TK1151

Lysosome / Vacuole0.366

Rank 2 · TkA08G112520 · TK1151

Cytoplasm0.198

Rank 3 · TkA08G112520 · TK1151

Golgi apparatus0.137

Rank 4 · TkA08G112520 · TK1151

Endoplasmic reticulum0.134

Rank 5 · TkA08G112520 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12698ABC2_membrane_3263-552 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G112520	`PF12698`	ABC2_membrane_3	263	552	2.9e-14	53.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9STT5`	Arabidopsis thaliana	sp\|Q9STT5\|AB7A_ARATH ABC transporter A family member 7	53.000%	Swiss-Prot	High
`Q9STT7`	Arabidopsis thaliana	sp\|Q9STT7\|AB5A_ARATH ABC transporter A family member 5	53.400%	Swiss-Prot	High
`Q1PEH6`	Arabidopsis thaliana	sp\|Q1PEH6\|AB3A_ARATH ABC transporter A family member 3	52.100%	Swiss-Prot	High
`Q8LPK0`	Arabidopsis thaliana	sp\|Q8LPK0\|AB8A_ARATH ABC transporter A family member 8	54.000%	Swiss-Prot	High
`Q9STT8`	Arabidopsis thaliana	sp\|Q9STT8\|AB4A_ARATH ABC transporter A family member 4	51.300%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card