LXL04_031361 | RubberDandelionOmics

Gene overview

LXL04_031361

Reference: OH-1004 Chr: Chr07 Coordinates: 4973011-4986603 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3483 bp · LXL04_031361|LXL04_031361|OH1004|cDNA

ATGGCGGACTCAACAGACGGTTCTTCTAGTTTCTGGACTCAAGTTGACGCTTTGTTCAGAAAGAATTTGACCTTTCAGAGAAGGAATTTGAAGACAAATATCAGGCTCGTATTATTCCCAGTCTTCCTCTGTTTATTACTCGTACTACTCGAAAAAATAGTCAACATTGAACTAGATAAACCCTCCTTAAAATGTGGTTGCACTTGTATTGATCAAGATGGAAATGGTGAATGCGAGAGAGTATGCGGGATTGAGTACTC...

CDS

Download CDS FASTA

3483 bp · LXL04_031361|LXL04_031361|OH1004|CDS

ATGGCGGACTCAACAGACGGTTCTTCTAGTTTCTGGACTCAAGTTGACGCTTTGTTCAGAAAGAATTTGACCTTTCAGAGAAGGAATTTGAAGACAAATATCAGGCTCGTATTATTCCCAGTCTTCCTCTGTTTATTACTCGTACTACTCGAAAAAATAGTCAACATTGAACTAGATAAACCCTCCTTAAAATGTGGTTGCACTTGTATTGATCAAGATGGAAATGGTGAATGCGAGAGAGTATGCGGGATTGAGTACTC...

Protein

Download Protein FASTA

1160 aa · LXL04_031361|LXL04_031361|OH1004|PROTEIN

MADSTDGSSSFWTQVDALFRKNLTFQRRNLKTNIRLVLFPVFLCLLLVLLEKIVNIELDKPSLKCGCTCIDQDGNGECERVCGIEYSDLKQVSTCSIPSPPEWPPFLQIPAPEYRAVKTDFLPFGDLPNDSCKSTGSCPTTLLITGNNQSLGESLARNMFPISSNFNSSHGLADVVLGSASKTQVSNILEPAFFSNLPVYYVQTHCGAKSSFNMSVPVGSTEVDKEIRCVEGQHLWRNSSSDINNELYTGYRRGNSEDKI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_031361`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_031361

Location Chr07:4973011-4986603 (+)

Description Similar to ABCA7: ABC transporter A family member 7

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g47780`	ABC transporter A family member 7.	No verified direct reference in this release
`At3g47760`	ABC transporter A family member 5.	No verified direct reference in this release
`At3g47740`	ABC transporter A family member 3.	No verified direct reference in this release
`At3g47790`	ABC transporter A family member 8.	No verified direct reference in this release
`At3g47750`	ABC transporter A family member 4.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_031361 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006869 lipid transport Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0016020 membrane Cellular Component

GO:0005319 lipid transporter activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0016887 ATP hydrolysis activity Molecular Function

GO:0042626 ATPase-coupled transmembrane transporter activity Molecular Function

GO:0140359 ABC-type transporter activity Molecular Function

KEGG gene cross-reference

ath:AT3G47740

ath:AT3G47760

ath:AT3G47780

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.358

Rank 1 · LXL04_031361 · OH-1004

Lysosome / Vacuole0.338

Rank 2 · LXL04_031361 · OH-1004

Cytoplasm0.202

Rank 3 · LXL04_031361 · OH-1004

Endoplasmic reticulum0.160

Rank 4 · LXL04_031361 · OH-1004

Golgi apparatus0.133

Rank 5 · LXL04_031361 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00005.34ABC_tran629-773 aa

PF13304.13AAA_21741-805 aa

PF24526.2ABCA12_C839-889 aa

PF13304.13AAA_21968-1040 aa

PF24526.2ABCA12_C1077-1120 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_031361	`PF00005.34`	ABC_tran	629	773	1.9e-29	103.8
LXL04_031361	`PF13304.13`	AAA_21	741	805	5.1e-21	76.6
LXL04_031361	`PF24526.2`	ABCA12_C	839	889	1.2e-50	170.2
LXL04_031361	`PF13304.13`	AAA_21	968	1040	5.1e-21	76.6
LXL04_031361	`PF24526.2`	ABCA12_C	1077	1120	1.2e-50	170.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9STT5`	Arabidopsis thaliana	ABC transporter A family member 7	60.632%	Swiss-Prot	strong database homology
`Q9STT7`	Arabidopsis thaliana	ABC transporter A family member 5	60.319%	Swiss-Prot	strong database homology
`Q1PEH6`	Arabidopsis thaliana	ABC transporter A family member 3	59.139%	Swiss-Prot	strong database homology
`Q8LPK0`	Arabidopsis thaliana	ABC transporter A family member 8	59.105%	Swiss-Prot	strong database homology
`Q9STT8`	Arabidopsis thaliana	ABC transporter A family member 4	58.360%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card