TkA08G102880 | RubberDandelionOmics

Gene overview

TkA08G102880

Reference: TK1151 Chr: Chr08 Coordinates: 26669700-26671168 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1068 bp · TkA08G102880|TK1151|cDNA

ATGATGGTGGACGTCCTAGAAGCTTATGCCGCCATCGGTATCCGTACGCGTATCCATAATCCCACTACTCTTCGCTCAGCTCCTTCTTTCAGGCGCACGAAGCTCGTAACCAAACCGAGTGCTGCCCTGACTGCTTCTTCGTCTCAGACAGAAGGTCGAACACTTGGTGGGCTGCTATTGCAACGGAAGCATGTCCCAAACGAAGTAAAACGAGATTATGACAATAATGATAATAACGTTATCATCAAGAACAAGAAAAG...

CDS

Download CDS FASTA

1068 bp · TkA08G102880|TK1151|CDS

ATGATGGTGGACGTCCTAGAAGCTTATGCCGCCATCGGTATCCGTACGCGTATCCATAATCCCACTACTCTTCGCTCAGCTCCTTCTTTCAGGCGCACGAAGCTCGTAACCAAACCGAGTGCTGCCCTGACTGCTTCTTCGTCTCAGACAGAAGGTCGAACACTTGGTGGGCTGCTATTGCAACGGAAGCATGTCCCAAACGAAGTAAAACGAGATTATGACAATAATGATAATAACGTTATCATCAAGAACAAGAAAAG...

Protein

Download Protein FASTA

355 aa · TkA08G102880|TK1151|PROTEIN

MMVDVLEAYAAIGIRTRIHNPTTLRSAPSFRRTKLVTKPSAALTASSSQTEGRTLGGLLLQRKHVPNEVKRDYDNNDNNVIIKNKKRVFFLDVNPICYDGSTPSLHSFAHWISLFFSEVSLTDPVIAVMDGEGAHEYRRQMLPSYKAHRRKIAPWVSNSRESANVPVRRSYQLISETLSKCNVPKRYAGCEDSRSRGRADDVVATLVEQVLEMDYRVVIASPDKDFKQLISQDVQLVMPLPELKRCGWCAWNPAFGAWFG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G102880`
TK1151 ID	TkA08G102880
OH-1004 ID	LXL04_031357
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	83.200
Protein coverage (%)	TK1151 98.873 / OH-1004 99.469 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA08G102880`
Location	Chr08:26669700-26671168 (-)
Description	Similar to aq_1628: 5'-3' exonuclease (Aquifex aeolicus (strain VF5)
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_031357` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006261 DNA-templated DNA replication Biological Process GO:0006302 double-strand break repair Biological Process GO:0033567 DNA replication, Okazaki fragment processing Biological Process GO:0005886 plasma membrane Cellular Component GO:0003677 DNA binding Molecular Function GO:0003887 DNA-directed DNA polymerase activity Molecular Function GO:0008408 3'-5' exonuclease activity Molecular Function GO:0008409 5'-3' exonuclease activity Molecular Function GO:0017108 5'-flap endonuclease activity Molecular Function
KEGG gene cross-reference	aae:aq_1628 mbo:BQ2027_MB1655 mle:ML1381 mtc:MT1665 mtu:Rv1629 mtv:RVBD_1629 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.832

Rank 1 · TkA08G102880 · TK1151

Mitochondrion0.125

Rank 2 · TkA08G102880 · TK1151

Nucleus0.072

Rank 3 · TkA08G102880 · TK1151

Cytoplasm0.050

Rank 4 · TkA08G102880 · TK1151

Cell membrane0.018

Rank 5 · TkA08G102880 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF027395_3_exonuc_N103-238 aa

PF013675_3_exonuc260-329 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G102880	`PF02739`	5_3_exonuc_N	103	238	3.2e-15	56.9
TkA08G102880	`PF01367`	5_3_exonuc	260	329	3.9e-08	34.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card