TkA08G087380 | RubberDandelionOmics

Gene overview

TkA08G087380

Reference: TK1151 Chr: Chr08 Coordinates: 22602534-22611911 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1301 bp · TkA08G087380|TK1151|cDNA

GAAAAATAAATAAAAAGGAAAAAAGCGGCAGCTGTACACCAAAACCAGAGTCTCCTCCGTTTTTGTTTCTTTCATCGCTCATCGATTTGAGCTAACACAAGATCGTCAAAATTTTAGCACAATCCAAGCACAATTTAACCAATTTTCATCAGAGATCGGGAACTGAGCTCACAATATTACAATTTTTTTCCGGTATTTCATTGTTTATGTTTCGATTTCGTTTAGCGAAATTTGTGATTGTTTCCGATCTTGATGTTTCG...

CDS

Download CDS FASTA

2292 bp · TkA08G087380|TK1151|CDS

ATGATTTCTGTTGGGAGTAGAGATGGTAGGAAGGGGTTAAGTTTGAGGTATGGTGTTGAAGGTGGAGATATGGATTTAGAGGCTGAACTTGAAGAAGGAGAGGCCTGTTTTCAGAACAATAACGACGATGATTCCACAATTGACCCCGATGTTGCTCTCTCTTATATTGATGAGAAACTTCAAGATGTGTTGGGACATTTTCAGAAGGATTTTGAAGGTGGAGTTTCAGCTGAAAATTTGGGGGCAAAGTTTGGGGGATA...

Protein

Download Protein FASTA

763 aa · TkA08G087380|TK1151|PROTEIN

MISVGSRDGRKGLSLRYGVEGGDMDLEAELEEGEACFQNNNDDDSTIDPDVALSYIDEKLQDVLGHFQKDFEGGVSAENLGAKFGGYGSFLPAYTRSPACPHPKTPPKIPTNNPSVSPNHMHIEGGRQSLVSISNISQSIKHGSVSTSGATTAPPPPPPPLKMNGKSKQEVHMLFNKNGGDKFASSNGQPVNNFANTCDPKSLKVRIKVGSDNLSTRKNAEIYSGLGLDVSPSSSLEASPVDSDDFCHMPNDSPHEESPT...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G087380`
TK1151 ID	TkA08G087380
OH-1004 ID	LXL04_018870
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	98.400
Protein coverage (%)	TK1151 99.083 / OH-1004 52.126 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G087380

Location Chr08:22602534-22611911 (+)

Description Protein of unknown function

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

No hit for this species in the current source table.

Rice

Reference gene ID	Possible function	Papers / DOI
`Os07g0669800`	Transcriptional activator that acts as a positive regulator of grain size.	No verified direct reference in this release
`Os05g0371100`	Binds to histones H3K4me1, H3K4me2 and H3K4me3 in GST pull-down assay.	No verified direct reference in this release
`Os03g0347300`	Binds to histones H3K4me1, H3K4me2 and H3K4me3 in GST pull-down assay.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_018870 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0045893 positive regulation of DNA-templated transcription Biological Process

GO:0080113 regulation of seed growth Biological Process

GO:0005634 nucleus Cellular Component

GO:0008270 zinc ion binding Molecular Function

GO:0043565 sequence-specific DNA binding Molecular Function

KEGG gene cross-reference

dosa:Os03g0347300

dosa:Os05g0371100

dosa:Os07g0669800

osa:4344236

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.958

Rank 1 · TkA08G087380 · TK1151

Cytoplasm0.126

Rank 2 · TkA08G087380 · TK1151

Cell membrane0.026

Rank 3 · TkA08G087380 · TK1151

Mitochondrion0.012

Rank 4 · TkA08G087380 · TK1151

Endoplasmic reticulum0.010

Rank 5 · TkA08G087380 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07496zf-CW587-632 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G087380	`PF07496`	zf-CW	587	632	9.3e-17	61.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`A0A0P0X9Z7`	Oryza sativa subsp. japonica	sp\|A0A0P0X9Z7\|CWZF7_ORYSJ Cysteine-tryptophan domain-containing zinc finger protein 7	32.300%	Swiss-Prot	Medium
`Q0DIQ5`	Oryza sativa subsp. japonica	sp\|Q0DIQ5\|CWZF5_ORYSJ Cysteine-tryptophan domain-containing zinc finger protein 5	30.400%	Swiss-Prot	Medium
`Q0DRX6`	Oryza sativa subsp. japonica	sp\|Q0DRX6\|CWZF3_ORYSJ Cysteine-tryptophan domain-containing zinc finger protein 3	37.300%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card